Lineage for d5kafc_ (5kaf C:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3028864Fold f.55: Photosystem II antenna protein-like [161076] (1 superfamily)
    6 transmembrane helices arranged in three antiparallel pairs (hairpins), segregated by cofactors; there can be insertions of different small subdomains in different exposed loops
  4. 3028865Superfamily f.55.1: Photosystem II antenna protein-like [161077] (1 family) (S)
    automatically mapped to Pfam PF00421
  5. 3028866Family f.55.1.1: Photosystem II antenna protein-like [161078] (3 proteins)
    Pfam PF00421
  6. 3028885Protein automated matches [191285] (5 species)
    not a true protein
  7. 3028895Species Thermosynechococcus elongatus [TaxId:197221] [260540] (5 PDB entries)
  8. 3028900Domain d5kafc_: 5kaf C: [327773]
    Other proteins in same PDB: d5kafa_, d5kafd_, d5kafe_, d5kaff_, d5kafh_, d5kafi1, d5kafi2, d5kafj_, d5kafk_, d5kafl_, d5kafm1, d5kafm2, d5kafo_, d5kaft1, d5kaft2, d5kafu_, d5kafv_, d5kafx_, d5kafz_
    automated match to d4pj0c_
    complexed with bcr, bct, cl, cla, dgd, fe2, hec, hem, lhg, lmg, oex, pho, pl9, sqd, unl

Details for d5kafc_

PDB Entry: 5kaf (more details), 3 Å

PDB Description: rt xfel structure of photosystem ii in the dark state at 3.0 a resolution
PDB Compounds: (C:) Photosystem II CP43 reaction center protein

SCOPe Domain Sequences for d5kafc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kafc_ f.55.1.1 (C:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
atnrdqessgfawwagnarlinlsgkllgahvahaglivfwagamtlfelahfipekpmy
eqgliliphiatlgwgvgpggevvdtfpffvvgvvhlissavlgfggvyhairgpetlee
yssffgydwkdknkmttilgfhlivlgigalllvakamffgglydtwapgggdvrvitnp
tldprvifgyllkspfggegwivsvnnledvvgghiwigliciaggiwhilttpfgwarr
afiwsgeaylsyslgalsmmgfiatcfvwfnntvypsefygptgpeasqaqamtflirdq
klganvgsaqgptglgkylmrsptgeiifggetmrfwdfrgpwleplrgpngldlnkikn
diqpwqerraaeymthaplgslnsvggvateinsvnfvsprswlatshfvlaffflvghl
whagraraaaagfekgidresepvlsmpsld

SCOPe Domain Coordinates for d5kafc_:

Click to download the PDB-style file with coordinates for d5kafc_.
(The format of our PDB-style files is described here.)

Timeline for d5kafc_: