Lineage for d5kafu_ (5kaf U:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1998615Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1999483Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 1999718Family a.60.12.2: PsbU-like [158539] (2 protein domains)
    Pfam PF06514
  6. 1999729Protein automated matches [191005] (3 species)
    not a true protein
  7. 1999730Species Thermosynechococcus elongatus [TaxId:197221] [260559] (5 PDB entries)
  8. 2284469Domain d5kafu_: 5kaf U: [327770]
    Other proteins in same PDB: d5kafa_, d5kafb_, d5kafc_, d5kafd_, d5kafe_, d5kafh_, d5kafi1, d5kafi2, d5kafj_, d5kafk_, d5kaft1, d5kaft2, d5kafv_, d5kafx_, d5kafz_
    automated match to d2axtu1
    complexed with bcr, bct, cl, cla, dgd, fe2, hem, lhg, lmg, oex, pho, pl9, sqd, unl

Details for d5kafu_

PDB Entry: 5kaf (more details), 3 Å

PDB Description: rt xfel structure of photosystem ii in the dark state at 3.0 a resolution
PDB Compounds: (U:) Photosystem II 12 kDa extrinsic protein

SCOPe Domain Sequences for d5kafu_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kafu_ a.60.12.2 (U:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
elvnvvdeklgtaygekidlnntniaafiqyrglyptlaklivknapyesvedvlnipgl
terqkqilrenlehftvtevetalveggdrynnglyk

SCOPe Domain Coordinates for d5kafu_:

Click to download the PDB-style file with coordinates for d5kafu_.
(The format of our PDB-style files is described here.)

Timeline for d5kafu_:

  • d5kafu_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-30