Lineage for d5o9ze1 (5o9z E:438-539)

  1. Root: SCOPe 2.07
  2. 2596047Class j: Peptides [58231] (148 folds)
  3. 2598106Fold j.144: Spliceosomal U4/U6 small nuclear ribonucleoprotein Prp3 N-terminal domain-like [345908] (1 superfamily)
    Extended helices and loops that interact with other spliceosome components
  4. 2598107Superfamily j.144.1: Spliceosomal U4/U6 small nuclear ribonucleoprotein Prp3 N-terminal domain-like [345944] (1 family) (S)
    Pfam PF08572
  5. 2598108Family j.144.1.1: Spliceosomal U4/U6 small nuclear ribonucleoprotein Prp3 N-terminal domain-like [346002] (1 protein)
  6. 2598109Protein Spliceosomal U4/U6 small nuclear ribonucleoprotein Prp3 [346145] (2 species)
  7. 2598112Species Human (Homo sapiens) [TaxId:9606] [346464] (1 PDB entry)
  8. 2598113Domain d5o9ze1: 5o9z E:438-539 [345811]
    Other proteins in same PDB: d5o9ze2, d5o9zg_, d5o9zh1, d5o9zh2, d5o9zi_, d5o9zk_, d5o9zp_, d5o9zv_, d5o9zx_, d5o9zy_
    protein/RNA complex

Details for d5o9ze1

PDB Entry: 5o9z (more details)

PDB Description: cryo-em structure of a pre-catalytic human spliceosome primed for activation (b complex)
PDB Compounds: (E:) U4/U6 small nuclear ribonucleoprotein Prp3

SCOPe Domain Sequences for d5o9ze1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5o9ze1 j.144.1.1 (E:438-539) Spliceosomal U4/U6 small nuclear ribonucleoprotein Prp3 {Human (Homo sapiens) [TaxId: 9606]}
vyltkkeqkklrrqtrreaqkelqekvrlglmpppepkvrisnlmrvlgteavqdptkve
ahvraqmakrqkaheeanaarkltaeqrkvkkikklkedisq

SCOPe Domain Coordinates for d5o9ze1:

Click to download the PDB-style file with coordinates for d5o9ze1.
(The format of our PDB-style files is described here.)

Timeline for d5o9ze1:

  • d5o9ze1 is new in SCOPe 2.07-stable