SCOPe 2.08: Domain d5o9ze1: 5o9z E:438-539

Lineage for d5o9ze1 (5o9z E:438-539)

1. Root: SCOPe 2.08

2. Class j: Peptides [58231] (151 folds)

3. Fold j.144: Spliceosomal U4/U6 small nuclear ribonucleoprotein Prp3 N-terminal domain-like [345908] (1 superfamily)
   Extended helices and loops that interact with other spliceosome components

4. Superfamily j.144.1: Spliceosomal U4/U6 small nuclear ribonucleoprotein Prp3 N-terminal domain-like [345944] (1 family)
   Pfam PF08572

5. Family j.144.1.1: Spliceosomal U4/U6 small nuclear ribonucleoprotein Prp3 N-terminal domain-like [346002] (1 protein)

6. Protein Spliceosomal U4/U6 small nuclear ribonucleoprotein Prp3 [346145] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [346464] (1 PDB entry)

8. Domain d5o9ze1: 5o9z E:438-539 [345811]
   Other proteins in same PDB: d5o9ze2, d5o9zg_, d5o9zh1, d5o9zh2, d5o9zi_, d5o9zk_, d5o9zp_, d5o9zv_, d5o9zx_, d5o9zy_
   protein/RNA complex

Details for d5o9ze1

PDB Entry: 5o9z

PDB Description: cryo-em structure of a pre-catalytic human spliceosome primed for activation (b complex)

PDB Compounds: (E:) U4/U6 small nuclear ribonucleoprotein Prp3

SCOPe Domain Sequences for d5o9ze1:

Sequence; same for both SEQRES and ATOM records:

>d5o9ze1 j.144.1.1 (E:438-539) Spliceosomal U4/U6 small nuclear ribonucleoprotein Prp3 {Human (Homo sapiens) [TaxId: 9606]}
vyltkkeqkklrrqtrreaqkelqekvrlglmpppepkvrisnlmrvlgteavqdptkve
ahvraqmakrqkaheeanaarkltaeqrkvkkikklkedisq

Timeline for d5o9ze1:

• d5o9ze1 first appeared in SCOPe 2.07