Lineage for d5o9zp_ (5o9z P:)

  1. Root: SCOPe 2.07
  2. 2596047Class j: Peptides [58231] (148 folds)
  3. 2598098Fold j.143: Pre-mRNA splicing factor Snu66-like [345907] (1 superfamily)
    Extended helical fragments
  4. 2598099Superfamily j.143.1: Pre-mRNA splicing factor Snu66-like [345943] (1 family) (S)
    Pfam PF03343
  5. 2598100Family j.143.1.1: Pre-mRNA splicing factor Sart1 / Snu66-like [346001] (1 protein)
  6. 2598101Protein Pre-mRNA splicing factor Sart1 / Snu66 [346144] (2 species)
  7. 2598104Species Human (Homo sapiens) [TaxId:9606] [346462] (1 PDB entry)
  8. 2598105Domain d5o9zp_: 5o9z P: [345818]
    Other proteins in same PDB: d5o9ze1, d5o9ze2, d5o9zg_, d5o9zh1, d5o9zh2, d5o9zi_, d5o9zk_, d5o9zv_, d5o9zx_, d5o9zy_
    protein/RNA complex

Details for d5o9zp_

PDB Entry: 5o9z (more details)

PDB Description: cryo-em structure of a pre-catalytic human spliceosome primed for activation (b complex)
PDB Compounds: (P:) U4/U6.U5 tri-snRNP-associated protein 1

SCOPe Domain Sequences for d5o9zp_:

Sequence, based on SEQRES records: (download)

>d5o9zp_ j.143.1.1 (P:) Pre-mRNA splicing factor Sart1 / Snu66 {Human (Homo sapiens) [TaxId: 9606]}
keagtkeepvtadvinpmalrqreelreklaaakekrllnqklgkiktlgeddpwlddta
awiersrqlqkekdlaekraklleemdqefgvstlveeefgqrrqdlysardlqgltveh
aidsfregetmiltlkdkgvlqeeedvlvnvnlvdkeraeknvelr

Sequence, based on observed residues (ATOM records): (download)

>d5o9zp_ j.143.1.1 (P:) Pre-mRNA splicing factor Sart1 / Snu66 {Human (Homo sapiens) [TaxId: 9606]}
keagtkeepvtadvinpmalrqreelreklaaakekrllnqklgkiktlgeddpwlddta
awiersrqlqkekvnvnlvdkeraeknvelr

SCOPe Domain Coordinates for d5o9zp_:

Click to download the PDB-style file with coordinates for d5o9zp_.
(The format of our PDB-style files is described here.)

Timeline for d5o9zp_:

  • d5o9zp_ is new in SCOPe 2.07-stable