Lineage for d5o9zy_ (5o9z y:)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2590045Fold g.101: Triquetra knot [345899] (1 superfamily)
    Triangular knot binding 3 zinc ions
  4. 2590046Superfamily g.101.1: Pre-mRNA splicing factor Phf5-like [345932] (1 family) (S)
    Pfam PF03660. Possible homology to LIM domains (57736) and to PHD domains (57911) discussed in PubMed 18621724
  5. 2590047Family g.101.1.1: Pre-mRNA splicing factor Phf5-like [345990] (1 protein)
  6. 2590048Protein Pre-mRNA splicing factor Phf5 / Rds3 [346131] (2 species)
  7. 2590052Species Human (Homo sapiens) [TaxId:9606] [346444] (4 PDB entries)
  8. 2590056Domain d5o9zy_: 5o9z y: [345821]
    Other proteins in same PDB: d5o9ze1, d5o9ze2, d5o9zg_, d5o9zh1, d5o9zh2, d5o9zi_, d5o9zk_, d5o9zp_, d5o9zv_, d5o9zx_
    protein/RNA complex

Details for d5o9zy_

PDB Entry: 5o9z (more details)

PDB Description: cryo-em structure of a pre-catalytic human spliceosome primed for activation (b complex)
PDB Compounds: (y:) PHD finger-like domain-containing protein 5A

SCOPe Domain Sequences for d5o9zy_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5o9zy_ g.101.1.1 (y:) Pre-mRNA splicing factor Phf5 / Rds3 {Human (Homo sapiens) [TaxId: 9606]}
dlifcrkqagvaigrlcekcdgkcvicdsyvrpctlvricdecnygsyqgrcvicggpgv
sdayyckectiqekdrdgcpkivnlgssk

SCOPe Domain Coordinates for d5o9zy_:

Click to download the PDB-style file with coordinates for d5o9zy_.
(The format of our PDB-style files is described here.)

Timeline for d5o9zy_:

  • d5o9zy_ is new in SCOPe 2.07-stable