Lineage for d5o9zh2 (5o9z H:36-333)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2341629Fold a.183: Nop domain [89123] (1 superfamily)
    multihelical; array of longer and shorter helices; contains an alpha-hairpin dimerisation subdomain
  4. 2341630Superfamily a.183.1: Nop domain [89124] (2 families) (S)
  5. 2341631Family a.183.1.1: Nop domain [89125] (2 proteins)
    putative snoRNA binding domain
  6. 2341635Protein U4/U6 small nuclear ribonucleoprotein Prp31 [158762] (2 species)
    contains insertion of a small 4-helical bundle at the tip of a long alpha-hairpin arm; this insertion approximately corresponds to the NOSIC (NUC001) domain; Pfam PF08060
  7. 2341638Species Human (Homo sapiens) [TaxId:9606] [158763] (2 PDB entries)
    Uniprot Q8WWY3 85-333
  8. 2341641Domain d5o9zh2: 5o9z H:36-333 [345815]
    Other proteins in same PDB: d5o9ze1, d5o9ze2, d5o9zg_, d5o9zh1, d5o9zi_, d5o9zk_, d5o9zp_, d5o9zv_, d5o9zx_, d5o9zy_
    protein/RNA complex

Details for d5o9zh2

PDB Entry: 5o9z (more details)

PDB Description: cryo-em structure of a pre-catalytic human spliceosome primed for activation (b complex)
PDB Compounds: (H:) U4/U6 small nuclear ribonucleoprotein Prp31

SCOPe Domain Sequences for d5o9zh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5o9zh2 a.183.1.1 (H:36-333) U4/U6 small nuclear ribonucleoprotein Prp31 {Human (Homo sapiens) [TaxId: 9606]}
qeetqldlsgdsvktiaklwdskmfaeimmkieeyiskqakasevmgpveaapeyrvivd
annltveienelniihkfirdkyskrfpeleslvpnaldyirtvkelgnsldkcknnenl
qqiltnatimvvsvtasttqgqqlseeelerleeacdmalelnaskhriyeyvesrmsfi
apnlsiiigastaakimgvaggltnlskmpacnimllgaqrktlsgfsstsvlphtgyiy
hsdivqslppdlrrkaarlvaakctlaarvdsfhestegkvgyelkdeierkfdkwqe

SCOPe Domain Coordinates for d5o9zh2:

Click to download the PDB-style file with coordinates for d5o9zh2.
(The format of our PDB-style files is described here.)

Timeline for d5o9zh2:

  • d5o9zh2 is new in SCOPe 2.07-stable