Class a: All alpha proteins [46456] (290 folds) |
Fold a.183: Nop domain [89123] (1 superfamily) multihelical; array of longer and shorter helices; contains an alpha-hairpin dimerisation subdomain |
Superfamily a.183.1: Nop domain [89124] (2 families) |
Family a.183.1.1: Nop domain [89125] (2 proteins) putative snoRNA binding domain |
Protein U4/U6 small nuclear ribonucleoprotein Prp31 [158762] (2 species) contains insertion of a small 4-helical bundle at the tip of a long alpha-hairpin arm; this insertion approximately corresponds to the NOSIC (NUC001) domain; Pfam PF08060 |
Species Human (Homo sapiens) [TaxId:9606] [158763] (2 PDB entries) Uniprot Q8WWY3 85-333 |
Domain d5o9zh2: 5o9z H:36-333 [345815] Other proteins in same PDB: d5o9ze1, d5o9ze2, d5o9zg_, d5o9zh1, d5o9zi_, d5o9zk_, d5o9zp_, d5o9zv_, d5o9zx_, d5o9zy_ protein/RNA complex has additional subdomain(s) that are not in the common domain |
PDB Entry: 5o9z (more details)
SCOPe Domain Sequences for d5o9zh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5o9zh2 a.183.1.1 (H:36-333) U4/U6 small nuclear ribonucleoprotein Prp31 {Human (Homo sapiens) [TaxId: 9606]} qeetqldlsgdsvktiaklwdskmfaeimmkieeyiskqakasevmgpveaapeyrvivd annltveienelniihkfirdkyskrfpeleslvpnaldyirtvkelgnsldkcknnenl qqiltnatimvvsvtasttqgqqlseeelerleeacdmalelnaskhriyeyvesrmsfi apnlsiiigastaakimgvaggltnlskmpacnimllgaqrktlsgfsstsvlphtgyiy hsdivqslppdlrrkaarlvaakctlaarvdsfhestegkvgyelkdeierkfdkwqe
Timeline for d5o9zh2: