Lineage for d5o9zx_ (5o9z x:)

  1. Root: SCOPe 2.07
  2. 2596047Class j: Peptides [58231] (148 folds)
  3. 2598120Fold j.146: Splicing factor 3B subunit 5 fragment [345910] (1 superfamily)
  4. 2598121Superfamily j.146.1: Splicing factor 3B subunit 5 fragment [345946] (1 family) (S)
    Pfam PF07189
  5. 2598122Family j.146.1.1: Splicing factor 3B subunit 5 fragment [346004] (1 protein)
  6. 2598123Protein Splicing factor 3B subunit 5 fragment [346147] (1 species)
  7. 2598124Species Human (Homo sapiens) [TaxId:9606] [346466] (1 PDB entry)
  8. 2598125Domain d5o9zx_: 5o9z x: [345820]
    Other proteins in same PDB: d5o9ze1, d5o9ze2, d5o9zg_, d5o9zh1, d5o9zh2, d5o9zi_, d5o9zk_, d5o9zp_, d5o9zv_, d5o9zy_
    protein/RNA complex

Details for d5o9zx_

PDB Entry: 5o9z (more details)

PDB Description: cryo-em structure of a pre-catalytic human spliceosome primed for activation (b complex)
PDB Compounds: (x:) Splicing factor 3B subunit 5

SCOPe Domain Sequences for d5o9zx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5o9zx_ j.146.1.1 (x:) Splicing factor 3B subunit 5 fragment {Human (Homo sapiens) [TaxId: 9606]}
tkwewlvnqhrdsycsymghfdllnyfaiaeneskarvrfnlmekmlqpcgppa

SCOPe Domain Coordinates for d5o9zx_:

Click to download the PDB-style file with coordinates for d5o9zx_.
(The format of our PDB-style files is described here.)

Timeline for d5o9zx_:

  • d5o9zx_ is new in SCOPe 2.07-stable