Lineage for d5o9zg_ (5o9z G:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332674Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2333768Superfamily a.118.8: TPR-like [48452] (10 families) (S)
  5. 2333769Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (21 protein domains)
  6. 2333873Protein Pre-mRNA splicing factor 6 [346027] (2 species)
  7. 2333876Species Human (Homo sapiens) [TaxId:9606] [346189] (1 PDB entry)
  8. 2333877Domain d5o9zg_: 5o9z G: [345813]
    Other proteins in same PDB: d5o9ze1, d5o9ze2, d5o9zh1, d5o9zh2, d5o9zi_, d5o9zk_, d5o9zp_, d5o9zv_, d5o9zx_, d5o9zy_
    protein/RNA complex

Details for d5o9zg_

PDB Entry: 5o9z (more details)

PDB Description: cryo-em structure of a pre-catalytic human spliceosome primed for activation (b complex)
PDB Compounds: (G:) Pre-mRNA-processing factor 6

SCOPe Domain Sequences for d5o9zg_:

Sequence, based on SEQRES records: (download)

>d5o9zg_ a.118.8.1 (G:) Pre-mRNA splicing factor 6 {Human (Homo sapiens) [TaxId: 9606]}
kpflgmpaplgyvpglgrgatgfttrsdigpardandpvddrhappgkrtvgdqmkknqa
addddedlndtnydefngyagslfssgpyekddeeadaiyaaldkrmderrkerreqrek
eeiekyrmerpkiqqqfsdlkrklaevteeewlsipevgdarnkrqrnpryekltpvpds
ffakhlqtgenhtsvdprqtqfgglntpypgglntpypggmtpglmtpgtgeldmrkigq
arntlmdmrlsqvsdsvsgqtvvdpkgyltdlnsmipthggdindikkarlllksvretn
phhppawiasarleevtgklqvarnlimkgtemcpksedvwleaarlqpgdtakavvaqa
vrhlpqsvriyiraaeletdirakkrvlrkalehvpnsvrlwkaaveleepedarimlsr
aveccptsvelwlalarletyenarkvlnkareniptdrhiwitaakleeangntqmvek
iidraitslrangveinreqwiqdaeecdragsvatcqavmravigigieeedrkhtwme
dadscvahnalecaraiyayalqvfpskksvwlraayfeknhgtresleallqravahcp
kaevlwlmgakskwlagdvpaarsilalafqanpnseeiwlaavklesendeyerarrll
akarssaptarvfmksvklewvqdniraaqdlceealrhyedfpklwmmkgqieeqkemm
ekareaynqglkkcphstplwlllsrleekigqltraraileksrlknpknpglwlesvr
leyraglkniantlmakalqecpnsgilwseaiflearpqrrtksvdalkkcehdphvll
avaklfwsqrkitkarewfhrtvkidsdlgdawaffykfelqhgteeqqeevrkrcesae
prhgelwcavskdianwqkkigdilrlvagrikntf

Sequence, based on observed residues (ATOM records): (download)

>d5o9zg_ a.118.8.1 (G:) Pre-mRNA splicing factor 6 {Human (Homo sapiens) [TaxId: 9606]}
kpflgmpaplgyvpglgrgatkddeeadaiyaaldkrmderrkerreqrekeeiekyrme
rpkiqqqfsdlkrklaevteeewlsipevgdarnkrqrnpryekltpvpdsffakhlqtg
enhtsvdprqtqfggyltdlnsmipthggdindikkarlllksvretnphhppawiasar
leevtgklqvarnlimkgtemcpksedvwleaarlqpgdtakavvaqavrhlpqsvriyi
raaeletdirakkrvlrkalehvpnsvrlwkaaveleepedarimlsraveccptsvelw
lalarletyenarkvlnkareniptdrhiwitaakleeangntqmvekiidraitslran
gveinreqwiqdaeecdragsvatcqavmravigigieeedrkhtwmedadscvahnale
caraiyayalqvfpskksvwlraayfeknhgtresleallqravahcpkaevlwlmgaks
kwlagdvpaarsilalafqanpnseeiwlaavklesendeyerarrllakarssaptarv
fmksvklewvqdniraaqdlceealrhyedfpklwmmkgqieeqkemmekareaynqglk
kcphstplwlllsrleekigqltraraileksrlknpknpglwlesvrleyraglknian
tlmakalqecpnsgilwseaiflearpqrrtksvdalkkcehdphvllavaklfwsqrki
tkarewfhrtvkidsdlgdawaffykfelqhgteeqqeevrkrcesaeprhgelwcavsk
dianwqkkigdilrlvagrikntf

SCOPe Domain Coordinates for d5o9zg_:

Click to download the PDB-style file with coordinates for d5o9zg_.
(The format of our PDB-style files is described here.)

Timeline for d5o9zg_:

  • d5o9zg_ is new in SCOPe 2.07-stable