PDB entry 5o9z

View 5o9z on RCSB PDB site
Description: Cryo-EM structure of a pre-catalytic human spliceosome primed for activation (B complex)
Class: splicing
Keywords: Spliceosome, pre-mRNA splicing, macromolecular complex, splicing
Deposited on 2017-06-20, released 2017-08-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-06, with a file datestamp of 2017-09-01.
Experiment type: EM
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: U2 small nuclear ribonucleoprotein B''
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain '2':
    Compound: Human gene for small nuclear RNA U2 (snRNA U2)
    Species: Homo sapiens [TaxId:9606]
  • Chain '4':
    Compound: homo sapiens u4a snrna
    Species: Homo sapiens [TaxId:9606]
  • Chain '5':
    Compound: Homo sapiens U5 A small nuclear RNA
    Species: Homo sapiens [TaxId:9606]
  • Chain '6':
    Compound: Homo sapiens RNA, U6 small nuclear 1 (RNU6-1), small nuclear RNA
    Species: Homo sapiens [TaxId:9606]
  • Chain 'A':
    Compound: Pre-mRNA-processing-splicing factor 8
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: 116 kDa U5 small nuclear ribonucleoprotein component
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: U5 small nuclear ribonucleoprotein 200 kDa helicase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: U5 small nuclear ribonucleoprotein 40 kDa protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: U4/U6 small nuclear ribonucleoprotein Prp3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5o9ze1, d5o9ze2
  • Chain 'F':
    Compound: U4/U6 small nuclear ribonucleoprotein PRP4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: Pre-mRNA-processing factor 6
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5o9zg_
  • Chain 'H':
    Compound: U4/U6 small nuclear ribonucleoprotein Prp31
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5o9zh1, d5o9zh2
  • Chain 'I':
    Compound: Pre-mRNA-splicing factor 38A
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5o9zi_
  • Chain 'J':
    Compound: thioredoxin-like protein 4a
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: Microfibrillar-associated protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5o9zk_
  • Chain 'L':
    Compound: WD40 repeat-containing protein SMU1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'M':
    Compound: Peptidyl-prolyl cis-trans isomerase H
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'N':
    Compound: Zinc finger matrin-type protein 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'O':
    Compound: NHP2-like protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'P':
    Compound: U4/U6.U5 tri-snRNP-associated protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5o9zp_
  • Chain 'Q':
    Compound: WW domain-binding protein 4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'R':
    Compound: Protein Red
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'S':
    Compound: Small nuclear ribonucleoprotein Sm D2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'T':
    Compound: Small nuclear ribonucleoprotein F
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'U':
    Compound: Small nuclear ribonucleoprotein E
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'V':
    Compound: Small nuclear ribonucleoprotein G
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'W':
    Compound: Small nuclear ribonucleoprotein Sm D3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'X':
    Compound: small nuclear ribonucleoprotein-associated proteins b and b'
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'Y':
    Compound: MINX pre-mRNA
    Species: Homo sapiens [TaxId:9606]
  • Chain 'Z':
    Compound: Small nuclear ribonucleoprotein Sm D1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'a':
    Compound: Small nuclear ribonucleoprotein Sm D2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'b':
    Compound: Small nuclear ribonucleoprotein F
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'c':
    Compound: Small nuclear ribonucleoprotein E
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'd':
    Compound: Small nuclear ribonucleoprotein G
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'e':
    Compound: Small nuclear ribonucleoprotein Sm D3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'f':
    Compound: small nuclear ribonucleoprotein-associated proteins b and b'
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'g':
    Compound: Small nuclear ribonucleoprotein Sm D1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'h':
    Compound: Small nuclear ribonucleoprotein Sm D2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'i':
    Compound: Small nuclear ribonucleoprotein F
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'j':
    Compound: Small nuclear ribonucleoprotein E
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'k':
    Compound: Small nuclear ribonucleoprotein G
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'l':
    Compound: Small nuclear ribonucleoprotein Sm D3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'm':
    Compound: small nuclear ribonucleoprotein-associated proteins b and b'
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'n':
    Compound: Small nuclear ribonucleoprotein Sm D1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'o':
    Compound: u6 snrna-associated sm-like protein lsm2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'p':
    Compound: U6 snRNA-associated Sm-like protein LSm3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'q':
    Compound: u6 snrna-associated sm-like protein lsm4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'r':
    Compound: U6 snRNA-associated Sm-like protein LSm5
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 's':
    Compound: U6 snRNA-associated Sm-like protein LSm6
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 't':
    Compound: U6 snRNA-associated Sm-like protein LSm7
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'u':
    Compound: U6 snRNA-associated Sm-like protein LSm8
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'v':
    Compound: Splicing factor 3B subunit 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5o9zv_
  • Chain 'w':
    Compound: Splicing factor 3B subunit 3 (SF3B3)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'x':
    Compound: Splicing factor 3B subunit 5
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5o9zx_
  • Chain 'y':
    Compound: PHD finger-like domain-containing protein 5A
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5o9zy_
  • Chain 'z':
    Compound: U2 small nuclear ribonucleoprotein A'
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09661
      • conflict (88)
      • conflict (118)
      • insertion (150)

PDB Chain Sequences:

  • Chain '1':
    No sequence available.

  • Chain '2':
    No sequence available.

  • Chain '4':
    No sequence available.

  • Chain '5':
    No sequence available.

  • Chain '6':
    No sequence available.

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5o9zE (E:)
    malskreldelkpwiektvkrvlgfseptvvtaalncvgkgmdkkkaadhlkpflddstl
    rfvdklfeaveegrssrhsksssdrsrkrelkevfgddseiskessgvkkrriprfeeve
    eepevipgppsespgmltklqikqmmeaatrqieerkkqlsfispptpqpktpsssqper
    lpigntiqpsqaatfmndaiekarkaaelqariqaqlalkpglignanmvglanlhamgi
    appkvelkdqtkptplildeqgrtvdatgkeielthrmptlkaniravkreqfkqqlkek
    psedmesntffdprvsiapsqrqrrtfkfhdkgkfekiaqrlrtkaqleklqaeisqaar
    ktgihtstrlaliapkkelkegdipeiewwdsyiipngfdlteenpkredyfgitnlveh
    paqlnppvdndtpvtlgvyltkkeqkklrrqtrreaqkelqekvrlglmpppepkvrisn
    lmrvlgteavqdptkveahvraqmakrqkaheeanaarkltaeqrkvkkikklkedisqg
    vhisvyrvrnlsnpakkfkieanagqlyltgvvvlhkdvnvvvveggpkaqkkfkrlmlh
    rikwdeqtsntkgdddeesdeeavkktnkcvlvwegtakdrsfgemkfkqcptenmareh
    fkkhgaehywdlalsesvlestd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5o9zE (E:)
    vyltkkeqkklrrqtrreaqkelqekvrlglmpppepkvrisnlmrvlgteavqdptkve
    ahvraqmakrqkaheeanaarkltaeqrkvkkikklkedisqgvhisvyrvrnlsnpakk
    fkieanagqlyltgvvvlhkdvnvvvveggpkaqkkfkrlmlhrikavkktnkcvlvweg
    takdrsfgemkfkqcptenmarehfkkhgaehywdlals
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5o9zG (G:)
    mnkkkkpflgmpaplgyvpglgrgatgfttrsdigpardandpvddrhappgkrtvgdqm
    kknqaaddddedlndtnydefngyagslfssgpyekddeeadaiyaaldkrmderrkerr
    eqrekeeiekyrmerpkiqqqfsdlkrklaevteeewlsipevgdarnkrqrnpryeklt
    pvpdsffakhlqtgenhtsvdprqtqfgglntpypgglntpypggmtpglmtpgtgeldm
    rkigqarntlmdmrlsqvsdsvsgqtvvdpkgyltdlnsmipthggdindikkarlllks
    vretnphhppawiasarleevtgklqvarnlimkgtemcpksedvwleaarlqpgdtaka
    vvaqavrhlpqsvriyiraaeletdirakkrvlrkalehvpnsvrlwkaaveleepedar
    imlsraveccptsvelwlalarletyenarkvlnkareniptdrhiwitaakleeangnt
    qmvekiidraitslrangveinreqwiqdaeecdragsvatcqavmravigigieeedrk
    htwmedadscvahnalecaraiyayalqvfpskksvwlraayfeknhgtresleallqra
    vahcpkaevlwlmgakskwlagdvpaarsilalafqanpnseeiwlaavklesendeyer
    arrllakarssaptarvfmksvklewvqdniraaqdlceealrhyedfpklwmmkgqiee
    qkemmekareaynqglkkcphstplwlllsrleekigqltraraileksrlknpknpglw
    lesvrleyraglkniantlmakalqecpnsgilwseaiflearpqrrtksvdalkkcehd
    phvllavaklfwsqrkitkarewfhrtvkidsdlgdawaffykfelqhgteeqqeevrkr
    cesaeprhgelwcavskdianwqkkigdilrlvagrikntf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5o9zG (G:)
    kpflgmpaplgyvpglgrgatkddeeadaiyaaldkrmderrkerreqrekeeiekyrme
    rpkiqqqfsdlkrklaevteeewlsipevgdarnkrqrnpryekltpvpdsffakhlqtg
    enhtsvdprqtqfggyltdlnsmipthggdindikkarlllksvretnphhppawiasar
    leevtgklqvarnlimkgtemcpksedvwleaarlqpgdtakavvaqavrhlpqsvriyi
    raaeletdirakkrvlrkalehvpnsvrlwkaaveleepedarimlsraveccptsvelw
    lalarletyenarkvlnkareniptdrhiwitaakleeangntqmvekiidraitslran
    gveinreqwiqdaeecdragsvatcqavmravigigieeedrkhtwmedadscvahnale
    caraiyayalqvfpskksvwlraayfeknhgtresleallqravahcpkaevlwlmgaks
    kwlagdvpaarsilalafqanpnseeiwlaavklesendeyerarrllakarssaptarv
    fmksvklewvqdniraaqdlceealrhyedfpklwmmkgqieeqkemmekareaynqglk
    kcphstplwlllsrleekigqltraraileksrlknpknpglwlesvrleyraglknian
    tlmakalqecpnsgilwseaiflearpqrrtksvdalkkcehdphvllavaklfwsqrki
    tkarewfhrtvkidsdlgdawaffykfelqhgteeqqeevrkrcesaeprhgelwcavsk
    dianwqkkigdilrlvagrikntf
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5o9zH (H:)
    msladelladleeaaeeeeggsygeeeeepaiedvqeetqldlsgdsvktiaklwdskmf
    aeimmkieeyiskqakasevmgpveaapeyrvivdannltveienelniihkfirdkysk
    rfpeleslvpnaldyirtvkelgnsldkcknnenlqqiltnatimvvsvtasttqgqqls
    eeelerleeacdmalelnaskhriyeyvesrmsfiapnlsiiigastaakimgvaggltn
    lskmpacnimllgaqrktlsgfsstsvlphtgyiyhsdivqslppdlrrkaarlvaakct
    laarvdsfhestegkvgyelkdeierkfdkwqepppvkqvkplpapldgqrkkrggrryr
    kmkerlglteirkqanrmsfgeieedayqedlgfslghlgksgsgrvrqtqvneatkari
    sktlqrtlqkqsvvyggkstirdrssgtassvaftplqgleivnpqaaekkvaeanqkyf
    ssmaeflkvkgeksglmst
    

    Sequence, based on observed residues (ATOM records): (download)
    >5o9zH (H:)
    qeetqldlsgdsvktiaklwdskmfaeimmkieeyiskqakasevmgpveaapeyrvivd
    annltveienelniihkfirdkyskrfpeleslvpnaldyirtvkelgnsldkcknnenl
    qqiltnatimvvsvtasttqgqqlseeelerleeacdmalelnaskhriyeyvesrmsfi
    apnlsiiigastaakimgvaggltnlskmpacnimllgaqrktlsgfsstsvlphtgyiy
    hsdivqslppdlrrkaarlvaakctlaarvdsfhestegkvgyelkdeierkfdkwqepp
    pvkqvkplpapldgqrkkrggrryrkmkerlglteirkqanrmsfgeieedayqedlgfs
    lghlgksgsgrvrqtqvneatkarisktlqrtlqkqsvvyggkstirdrssgt
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >5o9zI (I:)
    manrtvkdahsihgtnpqylvekiirtriyeskywkeecfgltaelvvdkamelrfvggv
    yggnikptpflcltlkmlqiqpekdiivefiknedfkyvrmlgalymrltgtaidcykyl
    eplyndyrkiksqnrngefelmhvdefidellhservcdiilprlqkryvleeaeqlepr
    vsaleedmddvesseeeeeedeklervpspdhrrrsyrdldkprrsptlryrrsrsrspr
    rrsrspkrrspsprrerhrsksprrhrsrsrdrrhrsrskspghhrshrhrshskspers
    kkshkksrrgne
    

    Sequence, based on observed residues (ATOM records): (download)
    >5o9zI (I:)
    manrtvkdahsihgtnpqylvekiirtriyeskywkeecfgltaelvvdkamelrfvggv
    yggnikptpflcltlkmlqiqpekdiivefiknedfkyvrmlgalymrltgtaidcykyl
    eplyndyrkiksqnrngefelmhvdefidellhservcdiilprlqkryvleeaeq
    

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >5o9zK (K:)
    msvpsalmkqppiqstagavpvrnekgeismekvkvkryvsgkrpdyapmessdeedeef
    qfikkakeqeaepeeqeedsssdprlrrlqnrisedveerlarhrkivepevvgesdsev
    egdawrmeredsseeeeeeiddeeierrrgmmrqraqerkneemevmevedegrsgeese
    seseyeeytdsedemeprlkpvfirkkdrvtvqereaealkqkeleqeakrmaeerrkyt
    lkiveeetkkeleenkrslaaldalntddendeeeyeawkvrelkrikrdredrealeke
    kaeiermrnlteeerraelrangkvitnkavkgkykflqkyyhrgaffmdedeevykrdf
    saptledhfnktilpkvmqvknfgrsgrtkythlvdqdttsfdsawgqesaqntkffkqk
    aagvrdvferpsakkrktt
    

    Sequence, based on observed residues (ATOM records): (download)
    >5o9zK (K:)
    endeeeyeawkvrelkrikrdredrealekekaeiermrnlteee
    

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    No sequence available.

  • Chain 'O':
    No sequence available.

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >5o9zP (P:)
    mgsskkhrgekeaagttaaagtggateqpprhrehkkhkhrsggsggsggerrkrsrerg
    gergsgrrgaeaearssthgrersqaepserrvkrekrddgyeaaassktssgdasslsi
    eetnklraklglkplevnaikkeagtkeepvtadvinpmalrqreelreklaaakekrll
    nqklgkiktlgeddpwlddtaawiersrqlqkekdlaekraklleemdqefgvstlveee
    fgqrrqdlysardlqgltvehaidsfregetmiltlkdkgvlqeeedvlvnvnlvdkera
    eknvelrkkkpdylpyaedesvddlaqqkprsilskydeelegerphsfrleqggtadgl
    rereleeiraklrlqaqslstvgprlaseyltpeemvtfkktkrrvkkirkkekevvvra
    ddllplgdqtqdgdfgsrlrgrgrrrvseveeekepvpqplpsddtrvenmdisdeeegg
    apppgspqvleedeaelelqkqlekgrrlrqlqqlqqlrdsgekvveivkklesrqrgwe
    ededperkgaivfnatsefcrtlgeiptyglagnreeqeelmdferdeersanggsesdg
    eenigwstvnldeekqqqdfsassttildeepivnrglaaalllcqnkgllettvqkvar
    vkapnkslpsavyciedkmaiddkysrreeyrgftqdfkekdgykpdvkieyvdetgrkl
    tpkeafrqlshrfhgkgsgkmkterrmkkldeeallkkmsssdtplgtvallqekqkaqk
    tpyivlsgsgksmnantitk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5o9zP (P:)
    keagtkeepvtadvinpmalrqreelreklaaakekrllnqklgkiktlgeddpwlddta
    awiersrqlqkekvnvnlvdkeraeknvelr
    

  • Chain 'Q':
    No sequence available.

  • Chain 'R':
    No sequence available.

  • Chain 'S':
    No sequence available.

  • Chain 'T':
    No sequence available.

  • Chain 'U':
    No sequence available.

  • Chain 'V':
    No sequence available.

  • Chain 'W':
    No sequence available.

  • Chain 'X':
    No sequence available.

  • Chain 'Y':
    No sequence available.

  • Chain 'Z':
    No sequence available.

  • Chain 'a':
    No sequence available.

  • Chain 'b':
    No sequence available.

  • Chain 'c':
    No sequence available.

  • Chain 'd':
    No sequence available.

  • Chain 'e':
    No sequence available.

  • Chain 'f':
    No sequence available.

  • Chain 'g':
    No sequence available.

  • Chain 'h':
    No sequence available.

  • Chain 'i':
    No sequence available.

  • Chain 'j':
    No sequence available.

  • Chain 'k':
    No sequence available.

  • Chain 'l':
    No sequence available.

  • Chain 'm':
    No sequence available.

  • Chain 'n':
    No sequence available.

  • Chain 'o':
    No sequence available.

  • Chain 'p':
    No sequence available.

  • Chain 'q':
    No sequence available.

  • Chain 'r':
    No sequence available.

  • Chain 's':
    No sequence available.

  • Chain 't':
    No sequence available.

  • Chain 'u':
    No sequence available.

  • Chain 'v':
    Sequence, based on SEQRES records: (download)
    >5o9zv (v:)
    makiakthedieaqireiqgkkaaldeaqgvgldstgyydqeiyggsdsrfagyvtsiaa
    teledddddyssstsllgqkkpgyhapvallndipqsteqydpfaehrppkiadredeyk
    khrrtmiisperldpfadggktpdpkmnartymdvmreqhltkeereirqqlaekakage
    lkvvngaaasqppskrkrrwdqtadqtpgatpkklsswdqaetpghtpslrwdetpgrak
    gsetpgatpgskiwdptpshtpagaatpgrgdtpghatpghggatssarknrwdetpkte
    rdtpghgsgwaetprtdrggdsigetptpgaskrksrwdetpasqmggstpvltpgktpi
    gtpamnmatptpghimsmtpeqlqawrwereidernrplsdeeldamfpegykvlpppag
    yvpirtparkltatptplggmtgfhmqtedrtmksvndqpsgnlpflkpddiqyfdkllv
    dvdestlspeeqkerkimklllkikngtppmrkaalrqitdkarefgagplfnqilpllm
    sptledqerhllvkvidrilyklddlvrpyvhkilvviepllidedyyarvegreiisnl
    akaaglatmistmrpdidnmdeyvrnttarafavvasalgipsllpflkavckskkswqa
    rhtgikivqqiailmgcailphlrslveiiehglvdeqqkvrtisalaiaalaeaatpyg
    iesfdsvlkplwkgirqhrgkglaaflkaigyliplmdaeyanyytrevmlilirefqsp
    deemkkivlkvvkqccgtdgveanyikteilppffkhfwqhrmaldrrnyrqlvdttvel
    ankvgaaeiisrivddlkdeaeqyrkmvmetiekimgnlgaadidhkleeqlidgilyaf
    qeqttedsvmlngfgtvvnalgkrvkpylpqicgtvlwrlnnksakvrqqaadlisrtav
    vmktcqeeklmghlgvvlyeylgeeypevlgsilgalkaivnvigmhkmtppikdllprl
    tpilknrhekvqencidlvgriadrgaeyvsarewmricfellellkahkkairratvnt
    fgyiakaigphdvlatllnnlkvqerqnrvcttvaiaivaetcspftvlpalmneyrvpe
    lnvqngvlkslsflfeyigemgkdyiyavtplledalmdrdlvhrqtasavvqhmslgvy
    gfgcedslnhllnyvwpnvfetsphviqavmgaleglrvaigpcrmlqyclqglfhpark
    vrdvywkiynsiyigsqdaliahypriynddkntyiryeldyil
    

    Sequence, based on observed residues (ATOM records): (download)
    >5o9zv (v:)
    eqkerkimklllkikngtppmrkaalrqitdkarefgagplfnqilpllmsptledqerh
    llvkvidrilyklddlvrpyvhkilvviepllidedyyarvegreiisnlakaaglatmi
    stmrpdidnmdeyvrnttarafavvasalgipsllpflkavckskkswqarhtgikivqq
    iailmgcailphlrslveiiehglvdeqqkvrtisalaiaalaeaatpygiesfdsvlkp
    lwkgirqhrgkglaaflkaigyliplmdaeyanyytrevmlilirefqspdeemkkivlk
    vvkqccgtdgveanyikteilppffkhfwqhrmaldrrnyrqlvdttvelankvgaaeii
    srivddlkdeaeqyrkmvmetiekimgnlgaadidhkleeqlidgilyafqeqttedsvm
    lngfgtvvnalgkrvkpylpqicgtvlwrlnnksakvrqqaadlisrtavvmktcqeekl
    mghlgvvlyeylgeeypevlgsilgalkaivnvigmhkmtppikdllprltpilknrhek
    vqencidlvgriadrgaeyvsarewmricfellellkahkkairratvntfgyiakaigp
    hdvlatllnnrvcttvaiaivaetcspftvlpalmneyrvpelnvqngvlkslsflfeyi
    gemgkdyiyavtplledalmdrdlvhrqtasavvqhmslgvygfgcedslnhllnyvwpn
    vfetsphviqavmgaleglrvaigpcrmlqyclqglfhparkvrdvywkiynsiyigsqd
    aliahypriynddkntyiryeldyil
    

  • Chain 'w':
    No sequence available.

  • Chain 'x':
    Sequence, based on SEQRES records: (download)
    >5o9zx (x:)
    mtdrytihsqlehlqskyigtghadttkwewlvnqhrdsycsymghfdllnyfaiaenes
    karvrfnlmekmlqpcgppadkpeen
    

    Sequence, based on observed residues (ATOM records): (download)
    >5o9zx (x:)
    tkwewlvnqhrdsycsymghfdllnyfaiaeneskarvrfnlmekmlqpcgppa
    

  • Chain 'y':
    Sequence, based on SEQRES records: (download)
    >5o9zy (y:)
    makhhpdlifcrkqagvaigrlcekcdgkcvicdsyvrpctlvricdecnygsyqgrcvi
    cggpgvsdayyckectiqekdrdgcpkivnlgssktdlfyerkkygfkkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5o9zy (y:)
    dlifcrkqagvaigrlcekcdgkcvicdsyvrpctlvricdecnygsyqgrcvicggpgv
    sdayyckectiqekdrdgcpkivnlgssk
    

  • Chain 'z':
    No sequence available.