Lineage for d5o9ze2 (5o9z E:540-675)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2953323Superfamily d.58.10: Acylphosphatase/BLUF domain-like [54975] (4 families) (S)
  5. 2953391Family d.58.10.3: Spliceosomal U4/U6 small nuclear ribonucleoprotein Prp3 C-terminal domain-like [345972] (1 protein)
    Pfam PF06544; relationship to BLUF domain discussed in PubMed 26161500
  6. 2953392Protein Spliceosomal U4/U6 small nuclear ribonucleoprotein Prp3 [346095] (2 species)
  7. 2953401Species Human (Homo sapiens) [TaxId:9606] [346361] (1 PDB entry)
  8. 2953402Domain d5o9ze2: 5o9z E:540-675 [345812]
    Other proteins in same PDB: d5o9ze1, d5o9zg_, d5o9zh1, d5o9zh2, d5o9zi_, d5o9zk_, d5o9zp_, d5o9zv_, d5o9zx_, d5o9zy_
    protein/RNA complex

Details for d5o9ze2

PDB Entry: 5o9z (more details)

PDB Description: cryo-em structure of a pre-catalytic human spliceosome primed for activation (b complex)
PDB Compounds: (E:) U4/U6 small nuclear ribonucleoprotein Prp3

SCOPe Domain Sequences for d5o9ze2:

Sequence, based on SEQRES records: (download)

>d5o9ze2 d.58.10.3 (E:540-675) Spliceosomal U4/U6 small nuclear ribonucleoprotein Prp3 {Human (Homo sapiens) [TaxId: 9606]}
gvhisvyrvrnlsnpakkfkieanagqlyltgvvvlhkdvnvvvveggpkaqkkfkrlml
hrikwdeqtsntkgdddeesdeeavkktnkcvlvwegtakdrsfgemkfkqcptenmare
hfkkhgaehywdlals

Sequence, based on observed residues (ATOM records): (download)

>d5o9ze2 d.58.10.3 (E:540-675) Spliceosomal U4/U6 small nuclear ribonucleoprotein Prp3 {Human (Homo sapiens) [TaxId: 9606]}
gvhisvyrvrnlsnpakkfkieanagqlyltgvvvlhkdvnvvvveggpkaqkkfkrlml
hrikavkktnkcvlvwegtakdrsfgemkfkqcptenmarehfkkhgaehywdlals

SCOPe Domain Coordinates for d5o9ze2:

Click to download the PDB-style file with coordinates for d5o9ze2.
(The format of our PDB-style files is described here.)

Timeline for d5o9ze2: