Lineage for d5o9zk_ (5o9z K:)

  1. Root: SCOPe 2.08
  2. 3045664Class j: Peptides [58231] (151 folds)
  3. 3047740Fold j.145: Microfibrillar-associated protein 1 fragment [345909] (1 superfamily)
  4. 3047741Superfamily j.145.1: Microfibrillar-associated protein 1 fragment [345945] (1 family) (S)
    Pfam PF06991
  5. 3047742Family j.145.1.1: Microfibrillar-associated protein 1 fragment [346003] (1 protein)
  6. 3047743Protein Microfibrillar-associated protein 1 fragment [346146] (1 species)
  7. 3047744Species Human (Homo sapiens) [TaxId:9606] [346465] (1 PDB entry)
  8. 3047745Domain d5o9zk_: 5o9z K: [345817]
    Other proteins in same PDB: d5o9ze1, d5o9ze2, d5o9zg_, d5o9zh1, d5o9zh2, d5o9zi_, d5o9zp_, d5o9zv_, d5o9zx_, d5o9zy_
    protein/RNA complex

Details for d5o9zk_

PDB Entry: 5o9z (more details)

PDB Description: cryo-em structure of a pre-catalytic human spliceosome primed for activation (b complex)
PDB Compounds: (K:) Microfibrillar-associated protein 1

SCOPe Domain Sequences for d5o9zk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5o9zk_ j.145.1.1 (K:) Microfibrillar-associated protein 1 fragment {Human (Homo sapiens) [TaxId: 9606]}
endeeeyeawkvrelkrikrdredrealekekaeiermrnlteee

SCOPe Domain Coordinates for d5o9zk_:

Click to download the PDB-style file with coordinates for d5o9zk_.
(The format of our PDB-style files is described here.)

Timeline for d5o9zk_: