Lineage for d5o9zv_ (5o9z v:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332674Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2332675Superfamily a.118.1: ARM repeat [48371] (27 families) (S)
  5. 2332829Family a.118.1.2: HEAT repeat [48385] (3 protein domains)
    Pfam PF02985
  6. 2332861Protein Splicing factor 3B subunit 1, HEAT repeats [346023] (1 species)
  7. 2332862Species Human (Homo sapiens) [TaxId:9606] [346183] (1 PDB entry)
  8. 2332863Domain d5o9zv_: 5o9z v: [345819]
    Other proteins in same PDB: d5o9ze1, d5o9ze2, d5o9zg_, d5o9zh1, d5o9zh2, d5o9zi_, d5o9zk_, d5o9zp_, d5o9zx_, d5o9zy_
    protein/RNA complex

Details for d5o9zv_

PDB Entry: 5o9z (more details)

PDB Description: cryo-em structure of a pre-catalytic human spliceosome primed for activation (b complex)
PDB Compounds: (v:) Splicing factor 3B subunit 1

SCOPe Domain Sequences for d5o9zv_:

Sequence, based on SEQRES records: (download)

>d5o9zv_ a.118.1.2 (v:) Splicing factor 3B subunit 1, HEAT repeats {Human (Homo sapiens) [TaxId: 9606]}
eqkerkimklllkikngtppmrkaalrqitdkarefgagplfnqilpllmsptledqerh
llvkvidrilyklddlvrpyvhkilvviepllidedyyarvegreiisnlakaaglatmi
stmrpdidnmdeyvrnttarafavvasalgipsllpflkavckskkswqarhtgikivqq
iailmgcailphlrslveiiehglvdeqqkvrtisalaiaalaeaatpygiesfdsvlkp
lwkgirqhrgkglaaflkaigyliplmdaeyanyytrevmlilirefqspdeemkkivlk
vvkqccgtdgveanyikteilppffkhfwqhrmaldrrnyrqlvdttvelankvgaaeii
srivddlkdeaeqyrkmvmetiekimgnlgaadidhkleeqlidgilyafqeqttedsvm
lngfgtvvnalgkrvkpylpqicgtvlwrlnnksakvrqqaadlisrtavvmktcqeekl
mghlgvvlyeylgeeypevlgsilgalkaivnvigmhkmtppikdllprltpilknrhek
vqencidlvgriadrgaeyvsarewmricfellellkahkkairratvntfgyiakaigp
hdvlatllnnlkvqerqnrvcttvaiaivaetcspftvlpalmneyrvpelnvqngvlks
lsflfeyigemgkdyiyavtplledalmdrdlvhrqtasavvqhmslgvygfgcedslnh
llnyvwpnvfetsphviqavmgaleglrvaigpcrmlqyclqglfhparkvrdvywkiyn
siyigsqdaliahypriynddkntyiryeldyil

Sequence, based on observed residues (ATOM records): (download)

>d5o9zv_ a.118.1.2 (v:) Splicing factor 3B subunit 1, HEAT repeats {Human (Homo sapiens) [TaxId: 9606]}
eqkerkimklllkikngtppmrkaalrqitdkarefgagplfnqilpllmsptledqerh
llvkvidrilyklddlvrpyvhkilvviepllidedyyarvegreiisnlakaaglatmi
stmrpdidnmdeyvrnttarafavvasalgipsllpflkavckskkswqarhtgikivqq
iailmgcailphlrslveiiehglvdeqqkvrtisalaiaalaeaatpygiesfdsvlkp
lwkgirqhrgkglaaflkaigyliplmdaeyanyytrevmlilirefqspdeemkkivlk
vvkqccgtdgveanyikteilppffkhfwqhrmaldrrnyrqlvdttvelankvgaaeii
srivddlkdeaeqyrkmvmetiekimgnlgaadidhkleeqlidgilyafqeqttedsvm
lngfgtvvnalgkrvkpylpqicgtvlwrlnnksakvrqqaadlisrtavvmktcqeekl
mghlgvvlyeylgeeypevlgsilgalkaivnvigmhkmtppikdllprltpilknrhek
vqencidlvgriadrgaeyvsarewmricfellellkahkkairratvntfgyiakaigp
hdvlatllnnrvcttvaiaivaetcspftvlpalmneyrvpelnvqngvlkslsflfeyi
gemgkdyiyavtplledalmdrdlvhrqtasavvqhmslgvygfgcedslnhllnyvwpn
vfetsphviqavmgaleglrvaigpcrmlqyclqglfhparkvrdvywkiynsiyigsqd
aliahypriynddkntyiryeldyil

SCOPe Domain Coordinates for d5o9zv_:

Click to download the PDB-style file with coordinates for d5o9zv_.
(The format of our PDB-style files is described here.)

Timeline for d5o9zv_:

  • d5o9zv_ is new in SCOPe 2.07-stable