Lineage for d5o9zh1 (5o9z H:334-448)

  1. Root: SCOPe 2.07
  2. 2596047Class j: Peptides [58231] (148 folds)
  3. 2598139Fold j.149: Spliceosomal U4/U6 small nuclear ribonucleoprotein Prp31 C-terminal domain-like [345913] (1 superfamily)
    Extended helices and loops that interact with other spliceosome components
  4. 2598140Superfamily j.149.1: Spliceosomal U4/U6 small nuclear ribonucleoprotein Prp31 C-terminal domain-like [345949] (1 family) (S)
    Pfam PF09785
  5. 2598141Family j.149.1.1: Spliceosomal U4/U6 small nuclear ribonucleoprotein Prp31 C-terminal domain-like [346007] (1 protein)
  6. 2598142Protein Spliceosomal U4/U6 small nuclear ribonucleoprotein Prp31 [346150] (2 species)
  7. 2598145Species Human (Homo sapiens) [TaxId:9606] [346470] (1 PDB entry)
  8. 2598146Domain d5o9zh1: 5o9z H:334-448 [345814]
    Other proteins in same PDB: d5o9ze1, d5o9ze2, d5o9zg_, d5o9zh2, d5o9zi_, d5o9zk_, d5o9zp_, d5o9zv_, d5o9zx_, d5o9zy_
    protein/RNA complex

Details for d5o9zh1

PDB Entry: 5o9z (more details)

PDB Description: cryo-em structure of a pre-catalytic human spliceosome primed for activation (b complex)
PDB Compounds: (H:) U4/U6 small nuclear ribonucleoprotein Prp31

SCOPe Domain Sequences for d5o9zh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5o9zh1 j.149.1.1 (H:334-448) Spliceosomal U4/U6 small nuclear ribonucleoprotein Prp31 {Human (Homo sapiens) [TaxId: 9606]}
pppvkqvkplpapldgqrkkrggrryrkmkerlglteirkqanrmsfgeieedayqedlg
fslghlgksgsgrvrqtqvneatkarisktlqrtlqkqsvvyggkstirdrssgt

SCOPe Domain Coordinates for d5o9zh1:

Click to download the PDB-style file with coordinates for d5o9zh1.
(The format of our PDB-style files is described here.)

Timeline for d5o9zh1:

  • d5o9zh1 is new in SCOPe 2.07-stable