SCOPe 2.08: Domain d5o9zh1: 5o9z H:334-448

Lineage for d5o9zh1 (5o9z H:334-448)

1. Root: SCOPe 2.08

2. Class j: Peptides [58231] (151 folds)

3. Fold j.149: Spliceosomal U4/U6 small nuclear ribonucleoprotein Prp31 C-terminal domain-like [345913] (1 superfamily)
   Extended helices and loops that interact with other spliceosome components

4. Superfamily j.149.1: Spliceosomal U4/U6 small nuclear ribonucleoprotein Prp31 C-terminal domain-like [345949] (1 family)
   Pfam PF09785

5. Family j.149.1.1: Spliceosomal U4/U6 small nuclear ribonucleoprotein Prp31 C-terminal domain-like [346007] (1 protein)

6. Protein Spliceosomal U4/U6 small nuclear ribonucleoprotein Prp31 [346150] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [346470] (1 PDB entry)

8. Domain d5o9zh1: 5o9z H:334-448 [345814]
   Other proteins in same PDB: d5o9ze1, d5o9ze2, d5o9zg_, d5o9zh2, d5o9zi_, d5o9zk_, d5o9zp_, d5o9zv_, d5o9zx_, d5o9zy_
   protein/RNA complex

Details for d5o9zh1

PDB Entry: 5o9z

PDB Description: cryo-em structure of a pre-catalytic human spliceosome primed for activation (b complex)

PDB Compounds: (H:) U4/U6 small nuclear ribonucleoprotein Prp31

SCOPe Domain Sequences for d5o9zh1:

Sequence; same for both SEQRES and ATOM records:

>d5o9zh1 j.149.1.1 (H:334-448) Spliceosomal U4/U6 small nuclear ribonucleoprotein Prp31 {Human (Homo sapiens) [TaxId: 9606]}
pppvkqvkplpapldgqrkkrggrryrkmkerlglteirkqanrmsfgeieedayqedlg
fslghlgksgsgrvrqtqvneatkarisktlqrtlqkqsvvyggkstirdrssgt

Timeline for d5o9zh1:

• d5o9zh1 first appeared in SCOPe 2.07