Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.74: DCoH-like [55247] (5 superfamilies) beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta |
Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (3 families) form homo and heterodimers |
Family d.74.3.2: RBP11/RpoL [64311] (4 proteins) |
Protein RNA polymerases I and III subunit AC19 [346100] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [346367] (1 PDB entry) |
Domain d4c3hk_: 4c3h K: [345100] Other proteins in same PDB: d4c3ha_, d4c3hb_, d4c3hc1, d4c3hc2, d4c3hd_, d4c3he1, d4c3he2, d4c3hf_, d4c3hg1, d4c3hg2, d4c3hh_, d4c3hi1, d4c3hi2, d4c3hj_, d4c3hl_, d4c3hm_, d4c3hn_ complexed with zn |
PDB Entry: 4c3h (more details), 3.27 Å
SCOPe Domain Sequences for d4c3hk_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4c3hk_ d.74.3.2 (K:) RNA polymerases I and III subunit AC19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} eepdrekiklltqatsedgtsasfqiveedhtlgnalryvimknpdvefcgysiphpsen llniriqtygettavdalqkglkdlmdlcdvveskftekiksm
Timeline for d4c3hk_: