Lineage for d4c3hk_ (4c3h K:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958012Fold d.74: DCoH-like [55247] (5 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 2958148Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (3 families) (S)
    form homo and heterodimers
  5. 2958258Family d.74.3.2: RBP11/RpoL [64311] (4 proteins)
  6. 2958265Protein RNA polymerases I and III subunit AC19 [346100] (1 species)
  7. 2958266Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [346367] (1 PDB entry)
  8. 2958267Domain d4c3hk_: 4c3h K: [345100]
    Other proteins in same PDB: d4c3ha_, d4c3hb_, d4c3hc1, d4c3hc2, d4c3hd_, d4c3he1, d4c3he2, d4c3hf_, d4c3hg1, d4c3hg2, d4c3hh_, d4c3hi1, d4c3hi2, d4c3hj_, d4c3hl_, d4c3hm_, d4c3hn_
    complexed with zn

Details for d4c3hk_

PDB Entry: 4c3h (more details), 3.27 Å

PDB Description: Structure of 14-subunit RNA polymerase I at 3.27 A resolution, crystal form C2-93
PDB Compounds: (K:) DNA-directed RNA polymerases I and III subunit rpac2

SCOPe Domain Sequences for d4c3hk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4c3hk_ d.74.3.2 (K:) RNA polymerases I and III subunit AC19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
eepdrekiklltqatsedgtsasfqiveedhtlgnalryvimknpdvefcgysiphpsen
llniriqtygettavdalqkglkdlmdlcdvveskftekiksm

SCOPe Domain Coordinates for d4c3hk_:

Click to download the PDB-style file with coordinates for d4c3hk_.
(The format of our PDB-style files is described here.)

Timeline for d4c3hk_: