Lineage for d4c3hd_ (4c3h D:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3039114Fold g.98: RNA polymerase I subunit A14-like [345896] (1 superfamily)
    alpha hairpin with 2 beta strands involved in heterodimeric interactions
  4. 3039115Superfamily g.98.1: RNA polymerase I subunit A14-like [345929] (1 family) (S)
    Pfam PF08203
    Homologous to N-terminal part of RpoF (69045) but does not include the HRDC domain (PubMed 18160037)
  5. 3039116Family g.98.1.1: RNA polymerase I subunit A14 [345987] (1 protein)
  6. 3039117Protein RNA polymerase I subunit A14 [346128] (1 species)
  7. 3039118Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [346439] (2 PDB entries)
  8. 3039119Domain d4c3hd_: 4c3h D: [345090]
    Other proteins in same PDB: d4c3ha_, d4c3hb_, d4c3hc1, d4c3hc2, d4c3he1, d4c3he2, d4c3hf_, d4c3hg1, d4c3hg2, d4c3hh_, d4c3hi1, d4c3hi2, d4c3hj_, d4c3hk_, d4c3hl_, d4c3hm_, d4c3hn_
    complexed with zn

Details for d4c3hd_

PDB Entry: 4c3h (more details), 3.27 Å

PDB Description: Structure of 14-subunit RNA polymerase I at 3.27 A resolution, crystal form C2-93
PDB Compounds: (D:) DNA-directed RNA polymerase I subunit rpa14

SCOPe Domain Sequences for d4c3hd_:

Sequence, based on SEQRES records: (download)

>d4c3hd_ g.98.1.1 (D:) RNA polymerase I subunit A14 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sattlntpvvihatqlpqhvstdevlqflesfidekeniidsttmntisgnaadadaaav
antslnidtnlsssisqlkriqrdfkglp

Sequence, based on observed residues (ATOM records): (download)

>d4c3hd_ g.98.1.1 (D:) RNA polymerase I subunit A14 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sattlntpvvihatqlpqhvstdevlqflesfidekentnlsssisqlkriqrdfkglp

SCOPe Domain Coordinates for d4c3hd_:

Click to download the PDB-style file with coordinates for d4c3hd_.
(The format of our PDB-style files is described here.)

Timeline for d4c3hd_: