Class g: Small proteins [56992] (100 folds) |
Fold g.98: RNA polymerase I subunit A14-like [345896] (1 superfamily) alpha hairpin with 2 beta strands involved in heterodimeric interactions |
Superfamily g.98.1: RNA polymerase I subunit A14-like [345929] (1 family) Pfam PF08203 Homologous to N-terminal part of RpoF (69045) but does not include the HRDC domain (PubMed 18160037) |
Family g.98.1.1: RNA polymerase I subunit A14 [345987] (1 protein) |
Protein RNA polymerase I subunit A14 [346128] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [346439] (2 PDB entries) |
Domain d4c3hd_: 4c3h D: [345090] Other proteins in same PDB: d4c3ha_, d4c3hb_, d4c3hc1, d4c3hc2, d4c3he1, d4c3he2, d4c3hf_, d4c3hg1, d4c3hg2, d4c3hh_, d4c3hi1, d4c3hi2, d4c3hj_, d4c3hk_, d4c3hl_, d4c3hm_, d4c3hn_ complexed with zn |
PDB Entry: 4c3h (more details), 3.27 Å
SCOPe Domain Sequences for d4c3hd_:
Sequence, based on SEQRES records: (download)
>d4c3hd_ g.98.1.1 (D:) RNA polymerase I subunit A14 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} sattlntpvvihatqlpqhvstdevlqflesfidekeniidsttmntisgnaadadaaav antslnidtnlsssisqlkriqrdfkglp
>d4c3hd_ g.98.1.1 (D:) RNA polymerase I subunit A14 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} sattlntpvvihatqlpqhvstdevlqflesfidekentnlsssisqlkriqrdfkglp
Timeline for d4c3hd_: