Lineage for d4c3hg1 (4c3h G:8-126)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2564565Fold d.230: Dodecin subunit-like [88797] (6 superfamilies)
    beta-alpha-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 132
  4. 2564566Superfamily d.230.1: N-terminal, heterodimerisation domain of RBP7 (RpoE) [88798] (3 families) (S)
    automatically mapped to Pfam PF03876
  5. 2564586Family d.230.1.2: RNA polymerase I subunit A43, N-terminal domain [345976] (1 protein)
  6. 2564587Protein RNA polymerase I subunit A43, N-terminal domain [346110] (1 species)
  7. 2564588Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [346396] (3 PDB entries)
  8. 2564591Domain d4c3hg1: 4c3h G:8-126 [345094]
    Other proteins in same PDB: d4c3ha_, d4c3hb_, d4c3hc1, d4c3hc2, d4c3hd_, d4c3he1, d4c3he2, d4c3hf_, d4c3hg2, d4c3hh_, d4c3hi1, d4c3hi2, d4c3hj_, d4c3hk_, d4c3hl_, d4c3hm_, d4c3hn_
    complexed with zn

Details for d4c3hg1

PDB Entry: 4c3h (more details), 3.27 Å

PDB Description: Structure of 14-subunit RNA polymerase I at 3.27 A resolution, crystal form C2-93
PDB Compounds: (G:) DNA-directed RNA polymerase I subunit rpa43

SCOPe Domain Sequences for d4c3hg1:

Sequence, based on SEQRES records: (download)

>d4c3hg1 d.230.1.2 (G:8-126) RNA polymerase I subunit A43, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
nenretarfikkhkkqvtnpidekngtsncivrvpialyvslapmylenplqgvmkqhln
plvmkynnkvggvvlgyeglkildadplskedtseklikitpdtpfgftwchvnlyvwq

Sequence, based on observed residues (ATOM records): (download)

>d4c3hg1 d.230.1.2 (G:8-126) RNA polymerase I subunit A43, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
nenretarfikkhkkqvtnpidekngtsncivrvpialyvslapmylenplqgvmkqhln
plvmkynnkvggvvlgyeglkildadpldtseklikitpdtpfgftwchvnlyvwq

SCOPe Domain Coordinates for d4c3hg1:

Click to download the PDB-style file with coordinates for d4c3hg1.
(The format of our PDB-style files is described here.)

Timeline for d4c3hg1:

  • d4c3hg1 is new in SCOPe 2.07-stable