Lineage for d4c3hg2 (4c3h G:127-316)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2381452Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2382744Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2383132Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (32 proteins)
    barrel, closed; n=5, S=8
  6. 2383540Protein RNA polymerase I subunit A43, C-terminal domain [346050] (1 species)
  7. 2383541Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [346240] (2 PDB entries)
  8. 2383542Domain d4c3hg2: 4c3h G:127-316 [345095]
    Other proteins in same PDB: d4c3ha_, d4c3hb_, d4c3hc1, d4c3hc2, d4c3hd_, d4c3he1, d4c3he2, d4c3hf_, d4c3hg1, d4c3hh_, d4c3hi1, d4c3hi2, d4c3hj_, d4c3hk_, d4c3hl_, d4c3hm_, d4c3hn_
    complexed with zn

Details for d4c3hg2

PDB Entry: 4c3h (more details), 3.27 Å

PDB Description: Structure of 14-subunit RNA polymerase I at 3.27 A resolution, crystal form C2-93
PDB Compounds: (G:) DNA-directed RNA polymerase I subunit rpa43

SCOPe Domain Sequences for d4c3hg2:

Sequence, based on SEQRES records: (download)

>d4c3hg2 b.40.4.5 (G:127-316) RNA polymerase I subunit A43, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pqvgdvlegyifiqsashigllihdafnasikknnipvdwtfvhndveedadvintdenn
gnnnnednkdsnggsnslgkfsfgnrslghwvdsngepidgklrftvrnvhttgrvvsvd
gtlisdadeegngynssrsqaeslpivsnkkivfddevsienkeshkeldlpevkedngs
eivyeentse

Sequence, based on observed residues (ATOM records): (download)

>d4c3hg2 b.40.4.5 (G:127-316) RNA polymerase I subunit A43, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pqvgdvlegyifiqsashigllihdafnasikknnipvdwtfvhndvelghwvdsngepi
dgklrftvrnvhttgrvvsvdgtlisynssrsqaeslpivsnkkivfddevsienkeshk
eldlpevkedngseivyeentse

SCOPe Domain Coordinates for d4c3hg2:

Click to download the PDB-style file with coordinates for d4c3hg2.
(The format of our PDB-style files is described here.)

Timeline for d4c3hg2:

  • d4c3hg2 is new in SCOPe 2.07-stable