SCOPe 2.08: Domain d4c3hc1: 4c3h C:30-75,C:222-335

Lineage for d4c3hc1 (4c3h C:30-75,C:222-335)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.74: DCoH-like [55247] (5 superfamilies)
   beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta

4. Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (3 families)
   form homo and heterodimers

5. Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (3 proteins)

6. Protein RNA polymerases I and III subunit AC40 [346099] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [346366] (2 PDB entries)

8. Domain d4c3hc1: 4c3h C:30-75,C:222-335 [345088]
   Other proteins in same PDB: d4c3ha_, d4c3hb_, d4c3hc2, d4c3hd_, d4c3he1, d4c3he2, d4c3hf_, d4c3hg1, d4c3hg2, d4c3hh_, d4c3hi1, d4c3hi2, d4c3hj_, d4c3hk_, d4c3hl_, d4c3hm_, d4c3hn_
   complexed with zn

Details for d4c3hc1

PDB Entry: 4c3h, 3.27 Å

PDB Description: Structure of 14-subunit RNA polymerase I at 3.27 A resolution, crystal form C2-93

PDB Compounds: (C:) DNA-directed RNA polymerases I and III subunit rpac1

SCOPe Domain Sequences for d4c3hc1:

Sequence; same for both SEQRES and ATOM records:

>d4c3hc1 d.74.3.1 (C:30-75,C:222-335) RNA polymerases I and III subunit AC40 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ewnvekfkkdfevnissldareanfdlinidtsianafrrimisevXvstasyrllpqin
ilqpikgesarrfqkcfppgvigidegsdeayvkdarkdtvsrevlryeefadkvklgrv
rnhfifnvesagamtpeeiffksvrilknkaeylkncpitq

Timeline for d4c3hc1:

• d4c3hc1 first appeared in SCOPe 2.07