Class g: Small proteins [56992] (100 folds) |
Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
Superfamily g.41.3: Zinc beta-ribbon [57783] (6 families) |
Family g.41.3.1: Transcriptional factor domain [57784] (6 proteins) |
Protein RNA polymerase I subunit A12.2 [346126] (1 species) contains two differently decorated domains of this fold |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [346434] (2 PDB entries) |
Domain d4c3hi1: 4c3h I:2-64 [345097] Other proteins in same PDB: d4c3ha_, d4c3hb_, d4c3hc1, d4c3hc2, d4c3hd_, d4c3he1, d4c3he2, d4c3hf_, d4c3hg1, d4c3hg2, d4c3hh_, d4c3hj_, d4c3hk_, d4c3hl_, d4c3hm_, d4c3hn_ complexed with zn |
PDB Entry: 4c3h (more details), 3.27 Å
SCOPe Domain Sequences for d4c3hi1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4c3hi1 g.41.3.1 (I:2-64) RNA polymerase I subunit A12.2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} svvgslifcldcgdllenpnavlgsnvecsqckaiypksqfsnlkvvtttaddafpsslr akk
Timeline for d4c3hi1: