Lineage for d4c3hi1 (4c3h I:2-64)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3036286Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 3036360Superfamily g.41.3: Zinc beta-ribbon [57783] (6 families) (S)
  5. 3036361Family g.41.3.1: Transcriptional factor domain [57784] (6 proteins)
  6. 3036419Protein RNA polymerase I subunit A12.2 [346126] (1 species)
    contains two differently decorated domains of this fold
  7. 3036420Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [346434] (2 PDB entries)
  8. 3036425Domain d4c3hi1: 4c3h I:2-64 [345097]
    Other proteins in same PDB: d4c3ha_, d4c3hb_, d4c3hc1, d4c3hc2, d4c3hd_, d4c3he1, d4c3he2, d4c3hf_, d4c3hg1, d4c3hg2, d4c3hh_, d4c3hj_, d4c3hk_, d4c3hl_, d4c3hm_, d4c3hn_
    complexed with zn

Details for d4c3hi1

PDB Entry: 4c3h (more details), 3.27 Å

PDB Description: Structure of 14-subunit RNA polymerase I at 3.27 A resolution, crystal form C2-93
PDB Compounds: (I:) DNA-directed RNA polymerase I subunit rpa12

SCOPe Domain Sequences for d4c3hi1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4c3hi1 g.41.3.1 (I:2-64) RNA polymerase I subunit A12.2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
svvgslifcldcgdllenpnavlgsnvecsqckaiypksqfsnlkvvtttaddafpsslr
akk

SCOPe Domain Coordinates for d4c3hi1:

Click to download the PDB-style file with coordinates for d4c3hi1.
(The format of our PDB-style files is described here.)

Timeline for d4c3hi1: