Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.11: RNA polymerase subunit RPB10 [46924] (1 family) automatically mapped to Pfam PF01194 |
Family a.4.11.1: RNA polymerase subunit RPB10 [46925] (2 proteins) Zn-binding site is near the N-terminus |
Protein RNA polymerase subunit RPB10 [46926] (3 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63490] (29 PDB entries) Uniprot P22139; part of multichain biological unit |
Domain d4c3hj_: 4c3h J: [345099] Other proteins in same PDB: d4c3ha_, d4c3hb_, d4c3hc1, d4c3hc2, d4c3hd_, d4c3he1, d4c3he2, d4c3hf_, d4c3hg1, d4c3hg2, d4c3hh_, d4c3hi1, d4c3hi2, d4c3hk_, d4c3hl_, d4c3hm_, d4c3hn_ complexed with zn |
PDB Entry: 4c3h (more details), 3.27 Å
SCOPe Domain Sequences for d4c3hj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4c3hj_ a.4.11.1 (J:) RNA polymerase subunit RPB10 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} mivpvrcfscgkvvgdkwesylnllqedeldegtalsrlglkryccrrmilthvdliekf lrynplekr
Timeline for d4c3hj_: