Lineage for d4c3hf_ (4c3h F:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2734750Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily)
    core: 2 helices and adjacent loops
  4. 2734751Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families) (S)
    the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits
  5. 2734802Family a.143.1.2: RPB6 [55294] (2 proteins)
  6. 2734803Protein RPB6 [55295] (3 species)
    essential subunit of RNA polymerases I, II and III
  7. 2734804Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64318] (31 PDB entries)
    Uniprot P20435; part of multichain biological unit
  8. 2734815Domain d4c3hf_: 4c3h F: [345093]
    Other proteins in same PDB: d4c3ha_, d4c3hb_, d4c3hc1, d4c3hc2, d4c3hd_, d4c3he1, d4c3he2, d4c3hg1, d4c3hg2, d4c3hh_, d4c3hi1, d4c3hi2, d4c3hj_, d4c3hk_, d4c3hl_, d4c3hm_, d4c3hn_
    complexed with zn

Details for d4c3hf_

PDB Entry: 4c3h (more details), 3.27 Å

PDB Description: Structure of 14-subunit RNA polymerase I at 3.27 A resolution, crystal form C2-93
PDB Compounds: (F:) DNA-directed RNA polymerases I, II, and III subunit rpabc 2

SCOPe Domain Sequences for d4c3hf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4c3hf_ a.143.1.2 (F:) RPB6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pedfqqheqirrktlkekaipkdqrattpymtkyerarilgtralqismnapvfvdlege
tdplriamkelaekkiplvirrylpdgsfedwsveelivd

SCOPe Domain Coordinates for d4c3hf_:

Click to download the PDB-style file with coordinates for d4c3hf_.
(The format of our PDB-style files is described here.)

Timeline for d4c3hf_: