Lineage for d4c3hc2 (4c3h C:76-221)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3004951Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily)
    unusual fold; contains a left-handed beta-alpha-beta unit
  4. 3004952Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family) (S)
    automatically mapped to Pfam PF01000
  5. 3004953Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (3 proteins)
  6. 3005028Protein RNA polymerases I and III subunit AC40 [346109] (1 species)
  7. 3005029Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [346394] (2 PDB entries)
  8. 3005032Domain d4c3hc2: 4c3h C:76-221 [345089]
    Other proteins in same PDB: d4c3ha_, d4c3hb_, d4c3hc1, d4c3hd_, d4c3he1, d4c3he2, d4c3hf_, d4c3hg1, d4c3hg2, d4c3hh_, d4c3hi1, d4c3hi2, d4c3hj_, d4c3hk_, d4c3hl_, d4c3hm_, d4c3hn_
    complexed with zn

Details for d4c3hc2

PDB Entry: 4c3h (more details), 3.27 Å

PDB Description: Structure of 14-subunit RNA polymerase I at 3.27 A resolution, crystal form C2-93
PDB Compounds: (C:) DNA-directed RNA polymerases I and III subunit rpac1

SCOPe Domain Sequences for d4c3hc2:

Sequence, based on SEQRES records: (download)

>d4c3hc2 d.181.1.1 (C:76-221) RNA polymerases I and III subunit AC40 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
psvaaeyvyffnntsviqdevlahriglvplkvdpdmltwvdsnlpddekftdentivls
lnvkctrnpdapkgstdpkelynnahvyardlkfepqgrqsttfadcpvvpadpdillak
lrpgqeislkahcilgiggdhakfsp

Sequence, based on observed residues (ATOM records): (download)

>d4c3hc2 d.181.1.1 (C:76-221) RNA polymerases I and III subunit AC40 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
psvaaeyvyffnntsviqdevlahriglvplkvdpdmltwvdsnlpddekftdentivls
lnvkctrnpdapstdpkelynnahvyardlkfepqgrqsttfadcpvvpadpdillaklr
pgqeislkahcilgiggdhakfsp

SCOPe Domain Coordinates for d4c3hc2:

Click to download the PDB-style file with coordinates for d4c3hc2.
(The format of our PDB-style files is described here.)

Timeline for d4c3hc2: