![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily) unusual fold; contains a left-handed beta-alpha-beta unit |
![]() | Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family) ![]() automatically mapped to Pfam PF01000 |
![]() | Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (3 proteins) |
![]() | Protein RNA polymerases I and III subunit AC40 [346109] (1 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [346394] (2 PDB entries) |
![]() | Domain d4c3hc2: 4c3h C:76-221 [345089] Other proteins in same PDB: d4c3ha_, d4c3hb_, d4c3hc1, d4c3hd_, d4c3he1, d4c3he2, d4c3hf_, d4c3hg1, d4c3hg2, d4c3hh_, d4c3hi1, d4c3hi2, d4c3hj_, d4c3hk_, d4c3hl_, d4c3hm_, d4c3hn_ complexed with zn |
PDB Entry: 4c3h (more details), 3.27 Å
SCOPe Domain Sequences for d4c3hc2:
Sequence, based on SEQRES records: (download)
>d4c3hc2 d.181.1.1 (C:76-221) RNA polymerases I and III subunit AC40 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} psvaaeyvyffnntsviqdevlahriglvplkvdpdmltwvdsnlpddekftdentivls lnvkctrnpdapkgstdpkelynnahvyardlkfepqgrqsttfadcpvvpadpdillak lrpgqeislkahcilgiggdhakfsp
>d4c3hc2 d.181.1.1 (C:76-221) RNA polymerases I and III subunit AC40 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} psvaaeyvyffnntsviqdevlahriglvplkvdpdmltwvdsnlpddekftdentivls lnvkctrnpdapstdpkelynnahvyardlkfepqgrqsttfadcpvvpadpdillaklr pgqeislkahcilgiggdhakfsp
Timeline for d4c3hc2: