Lineage for d4c3hm_ (4c3h M:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2397876Fold b.65: triple barrel [50915] (1 superfamily)
    dimer of two non-identical subunits; forms two similar barrels, n=8, S=10 each, that are fused together with the formation of third barrel, n=6, S=8
  4. 2397877Superfamily b.65.1: Rap30/74 interaction domain-like [50916] (3 families) (S)
  5. 2397891Family b.65.1.2: RNA polymerase I A49/34.5, interaction domains [345965] (3 proteins)
    Homology with TFIIF discussed in PubMed 20797630
  6. 2397910Protein RNA polymerase I subunit A49, interaction domain [346058] (2 species)
    N-terminal part of Pfam PF06870
  7. 2397911Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [346252] (2 PDB entries)
  8. 2397914Domain d4c3hm_: 4c3h M: [345102]
    Other proteins in same PDB: d4c3ha_, d4c3hb_, d4c3hc1, d4c3hc2, d4c3hd_, d4c3he1, d4c3he2, d4c3hf_, d4c3hg1, d4c3hg2, d4c3hh_, d4c3hi1, d4c3hi2, d4c3hj_, d4c3hk_, d4c3hl_, d4c3hn_
    complexed with zn

Details for d4c3hm_

PDB Entry: 4c3h (more details), 3.27 Å

PDB Description: Structure of 14-subunit RNA polymerase I at 3.27 A resolution, crystal form C2-93
PDB Compounds: (M:) DNA-directed RNA polymerase I subunit RPA49

SCOPe Domain Sequences for d4c3hm_:

Sequence, based on SEQRES records: (download)

>d4c3hm_ b.65.1.2 (M:) RNA polymerase I subunit A49, interaction domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
seieiesvqdqpsvavgsffkgfrapsdttfdlykkkksekdefvlhgenerleyegytd
sssqasnqyvvglfnpekksiqlykapvlvskvvskssknlrgpkik

Sequence, based on observed residues (ATOM records): (download)

>d4c3hm_ b.65.1.2 (M:) RNA polymerase I subunit A49, interaction domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
seieiesvqdqpsvavgsffkgfrapsdttfdlykkkekdefvlhgenerleyegytdss
sqasnqyvvglfnpekksiqlykapvlvskvvskssknlrgpkik

SCOPe Domain Coordinates for d4c3hm_:

Click to download the PDB-style file with coordinates for d4c3hm_.
(The format of our PDB-style files is described here.)

Timeline for d4c3hm_:

  • d4c3hm_ is new in SCOPe 2.07-stable