Lineage for d4c3hb_ (4c3h B:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2574250Fold e.29: beta and beta-prime subunits of DNA dependent RNA-polymerase [64483] (1 superfamily)
    Multidomain subunits of complex domain organization
  4. 2574251Superfamily e.29.1: beta and beta-prime subunits of DNA dependent RNA-polymerase [64484] (2 families) (S)
    The catalytic site is formed by the association of two double-psi beta-barrel domains, one from each subunit
  5. 2574252Family e.29.1.1: RNA-polymerase beta [64485] (4 proteins)
  6. 2574285Protein RNA polymerase I subunit A135 [346117] (1 species)
  7. 2574286Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [346414] (3 PDB entries)
  8. 2574289Domain d4c3hb_: 4c3h B: [345087]
    Other proteins in same PDB: d4c3ha_, d4c3hc1, d4c3hc2, d4c3hd_, d4c3he1, d4c3he2, d4c3hf_, d4c3hg1, d4c3hg2, d4c3hh_, d4c3hi1, d4c3hi2, d4c3hj_, d4c3hk_, d4c3hl_, d4c3hm_, d4c3hn_
    complexed with zn

Details for d4c3hb_

PDB Entry: 4c3h (more details), 3.27 Å

PDB Description: Structure of 14-subunit RNA polymerase I at 3.27 A resolution, crystal form C2-93
PDB Compounds: (B:) DNA-directed RNA polymerase I subunit rpa135

SCOPe Domain Sequences for d4c3hb_:

Sequence, based on SEQRES records: (download)

>d4c3hb_ e.29.1.1 (B:) RNA polymerase I subunit A135 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
rtadfrtleresrfinppkdksafpllqeavqphigsfnaltegpdggllnlgvkdigek
vifdgkplnsedeisnsgylgnklsvsveqvsiakpmsndgvssaverkvypsesrqrlt
syrgklllklkwsvnngeenlfevrdcgglpvmlqsnrchlnkmspyelvqhkeesdeig
gyfivngieklirmlivqrrnhpmaiirpsfanrgasyshygiqirsvrpdqtsqtnvlh
ylndgqvtfrfswrkneylvpvvmilkalchtsdreifdgiigndvkdsfltdrlelllr
gfkkryphlqnrtqvlqylgdkfrvvfqaspdqsdlevgqevldrivlvhlgkdgsqdkf
rmllfmirklyslvagecspdnpdatqhqevllggflygmilkekideylqniiaqvrmd
inrgmainfkdkrymsrvlmrvnenigskmqyflstgnlvsqsgldlqqvsgytvvaeki
nfyrfishfrmvhrgsffaqlktttvrkllpeswgflcpvhtpdgspcgllnhfahkcri
stqqsdvsripsilyslgvapashtfaagpslccvqidgkiigwvsheqgkiiadtlryw
kvegktpglpidleigyvppstrgqypglylfgghsrmlrpvrylpldkedivgpfeqvy
mniavtpqeiqnnvhthveftptnilsilanltpfsdfnqsprnmyqcqmgkqtmgtpgv
alchrsdnklyrlqtgqtpivkanlyddygmdnfpngfnavvavisytgydmddamiink
sadergfgygtmyktekvdlalnrnrgdpitqhfgfgndewpkewlekldedglpyigty
veegdpicayfddtlnktkiktyhssepayieevnligdesnkfqelqtvsikyrirrtp
qigdkfssrhgqkgvcsrkwptidmpfsetgiqpdiiinphafpsrmtigmfveslagka
galhgiaqdstpwifneddtpadyfgeqlakagynyhgnepmysgatgeelradiyvgvv
yyqrlrhmvndkfqvrstgpvnsltmqpvkgrkrhggirvgemerdalighgtsfllqdr
llnssdytqasvcrecgsilttqqsvprigsistvccrrcsmrfedakklltksedgeki
fiddsqiwedgqgnkfvggnetttvaipfvlkyldselsamgirlrynvepk

Sequence, based on observed residues (ATOM records): (download)

>d4c3hb_ e.29.1.1 (B:) RNA polymerase I subunit A135 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
rtadfrtleresrfinppkdksafpllqeavqphigsfnaltegpdggllnlgvkdigek
vifdgkplnseeisnsgylgnklsvsveqvsiakpmsndsaverkvypsesrqrltsyrg
klllklkwsvnngeenlfevrdcgglpvmlqsnrchlnkmspyelvqhkeesdeiggyfi
vngieklirmlivqrrnhpmaiirpsfanrgasyshygiqirsvrpdqtsqtnvlhylnd
gqvtfrfswrkneylvpvvmilkalchtsdreifdgiigndvkdsfltdrlelllrgfkk
ryphlqnrtqvlqylgdkfrvvfqaspdqsdlevgqevldrivlvhlgkdgsqdkfrmll
fmirklyslvagecspdnpdatqhqevllggflygmilkekideylqniiaqvrmdinrg
mainfkdkrymsrvlmrvnenigskmqyflstgnlvsqsgldlqqvsgytvvaekinfyr
fishfrmvhrgsffaqlktttvrkllpeswgflcpvhtpdgspcgllnhfahkcristqq
sdvsripsilyslgvapashtfaagpslccvqidgkiigwvsheqgkiiadtlrywkveg
ktpglpidleigyvppstrgqypglylfgghsrmlrpvrylpldkedivgpfeqvymnia
vtpqeiqnnvhthveftptnilsilanltpfsdfnqsprnmyqcqmgkqtmgtpgvalch
rsdnklyrlqtgqtpivkanlyddygmdnfpngfnavvavisytgydmddamiinksade
rgfgygtmyktekvdlaldpitqhfgfgndewpkewlekldedglpyigtyveegdpica
yfddtlnktkiktyhssepayieevnligdesnkfqelqtvsikyrirrtpqigdkfssr
hgqkgvcsrkwptidmpfsetgiqpdiiinphafpsrmtigmfveslagkagalhgiaqd
stpwifneddtpadyfgeqlakagynyhgnepmysgatgeelradiyvgvvyyqrlrhmv
ndkfqvrstgpvnsltmqpvkgrkrhggirvgemerdalighgtsfllqdrllnssdytq
asvcrecgsilttqqsvprigsistvccrrcsmrfedakkgekifiddsqiwedgqgnkf
vggnetttvaipfvlkyldselsamgirlrynvepk

SCOPe Domain Coordinates for d4c3hb_:

Click to download the PDB-style file with coordinates for d4c3hb_.
(The format of our PDB-style files is described here.)

Timeline for d4c3hb_:

  • d4c3hb_ is new in SCOPe 2.07-stable