Lineage for d3jb9x1 (3jb9 X:461-615)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2390559Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies)
    barrel, closed; n=6, S=8; greek-key
    Many cradle-loop superfamilies may be homologous, according to PubMed 18457946
  4. 2391012Superfamily b.49.4: Upf1 barrel domain-like [345920] (1 family) (S)
    barrel topology is 125436
  5. 2391013Family b.49.4.1: Upf1 barrel domain-like [345963] (2 proteins)
  6. 2391014Protein Pre-mRNA splicing factor Cwf11 / Aquarius barrel domain [346054] (2 species)
  7. 2391017Species Schizosaccharomyces pombe 972h- [TaxId:284812] [346247] (1 PDB entry)
  8. 2391018Domain d3jb9x1: 3jb9 X:461-615 [344823]
    Other proteins in same PDB: d3jb9a1, d3jb9a2, d3jb9a3, d3jb9a4, d3jb9a5, d3jb9b1, d3jb9b2, d3jb9b3, d3jb9b4, d3jb9b5, d3jb9c_, d3jb9e_, d3jb9f_, d3jb9g_, d3jb9h_, d3jb9i_, d3jb9j_, d3jb9k_, d3jb9l_, d3jb9m_, d3jb9r_, d3jb9s1, d3jb9s2, d3jb9t1, d3jb9t2, d3jb9u1, d3jb9u2, d3jb9u3, d3jb9v1, d3jb9v2, d3jb9w_, d3jb9x2, d3jb9x3, d3jb9x4, d3jb9y1, d3jb9y2, d3jb9z_
    protein/RNA complex; complexed with adp, gdp, mg, zn

Details for d3jb9x1

PDB Entry: 3jb9 (more details), 3.6 Å

PDB Description: cryo-em structure of the yeast spliceosome at 3.6 angstrom resolution
PDB Compounds: (X:) Pre-mRNA-splicing factor cwf11

SCOPe Domain Sequences for d3jb9x1:

Sequence, based on SEQRES records: (download)

>d3jb9x1 b.49.4.1 (X:461-615) Pre-mRNA splicing factor Cwf11 / Aquarius barrel domain {Schizosaccharomyces pombe 972h- [TaxId: 284812]}
rrlsiknatknltkdnffslnnfkvtsvappqigqvlpqfvkcqmglsrpgpfhsalrdl
knsikspflcliyiskdmeykllhgnaldplegvtdftiaticnddvgmfqsdmqsdsdn
ksinvylspfyyhslaglgeyrpkqlkfnfalvls

Sequence, based on observed residues (ATOM records): (download)

>d3jb9x1 b.49.4.1 (X:461-615) Pre-mRNA splicing factor Cwf11 / Aquarius barrel domain {Schizosaccharomyces pombe 972h- [TaxId: 284812]}
rrlsiknatknlnffslnnfkvtsvaplpqfvkcqmglsrpsalrdlknsspflcliyis
kdmeykllhgnaldplevtdftiaticnddvgmfmqsdsdnksinvylspfyyhslaglg
eyrpkqlkfnfalvls

SCOPe Domain Coordinates for d3jb9x1:

Click to download the PDB-style file with coordinates for d3jb9x1.
(The format of our PDB-style files is described here.)

Timeline for d3jb9x1:

  • d3jb9x1 is new in SCOPe 2.07-stable