Lineage for d3jb9k_ (3jb9 K:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2399102Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2399257Superfamily b.69.4: WD40 repeat-like [50978] (4 families) (S)
    also contains 8-bladed propellers
  5. 2399258Family b.69.4.1: WD40-repeat [50979] (17 protein domains)
  6. 2399375Protein Pre-mRNA splicing factor Prp5 / Cwf1 [346064] (1 species)
  7. 2399376Species Schizosaccharomyces pombe 972h- [TaxId:284812] [346261] (1 PDB entry)
  8. 2399377Domain d3jb9k_: 3jb9 K: [344809]
    Other proteins in same PDB: d3jb9a1, d3jb9a2, d3jb9a3, d3jb9a4, d3jb9a5, d3jb9b1, d3jb9b2, d3jb9b3, d3jb9b4, d3jb9b5, d3jb9c_, d3jb9e_, d3jb9f_, d3jb9g_, d3jb9h_, d3jb9i_, d3jb9j_, d3jb9l_, d3jb9m_, d3jb9r_, d3jb9s1, d3jb9s2, d3jb9t1, d3jb9t2, d3jb9u1, d3jb9u2, d3jb9u3, d3jb9v1, d3jb9v2, d3jb9w_, d3jb9x1, d3jb9x2, d3jb9x3, d3jb9x4, d3jb9y1, d3jb9y2, d3jb9z_
    protein/RNA complex; complexed with adp, gdp, mg, zn

Details for d3jb9k_

PDB Entry: 3jb9 (more details), 3.6 Å

PDB Description: cryo-em structure of the yeast spliceosome at 3.6 angstrom resolution
PDB Compounds: (K:) Pre-mRNA-splicing factor prp5

SCOPe Domain Sequences for d3jb9k_:

Sequence, based on SEQRES records: (download)

>d3jb9k_ b.69.4.1 (K:) Pre-mRNA splicing factor Prp5 / Cwf1 {Schizosaccharomyces pombe 972h- [TaxId: 284812]}
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxwhapwtlmrvisghlgwvrcvdvepgnqwfctgagdrtikiwdlasgvl
kltltghiatvrglavsprhpylfscgedkmvkcwdletnkvirhyhghlsgvyalklhp
tldvlvtagrdavarvwdmrtrqnvhvlsghkstvaslavqefdpqvvtgsmdstirlwd
laagktlttlthhkktvralslhpdeftfasgssdnikhwkfpegafmgnfeghnaivnt
lsinsdnvmfsgadngsmcfwdwksghkyqelqsvvqpgsldseagifassfdktglrli
tceadksvkiykqvdnatpethpnlpwtpsnlr

Sequence, based on observed residues (ATOM records): (download)

>d3jb9k_ b.69.4.1 (K:) Pre-mRNA splicing factor Prp5 / Cwf1 {Schizosaccharomyces pombe 972h- [TaxId: 284812]}
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxwhapwtlmr
visghlgwvrcvdvepgnqwfctgagdrtikiwdlasgvlkltltghiatvrglavsprh
pylfscgedkmvkcwdletnkvirhyhghlsgvyalklhptldvlvtagrdavarvwdmr
trqnvhvlsghkstvaslavqefdpqvvtgsmdstirlwdlaagktlttlthhkktvral
slhpdeftfasgssdnikhwkfpegafmgnfeghnaivntlsinsdnvmfsgadngsmcf
wdwksghkyqelqsvvqpgsldseagifassfdktglrlitceadksvkiykqvdnatpe
thpnlpwtpsnlr

SCOPe Domain Coordinates for d3jb9k_:

Click to download the PDB-style file with coordinates for d3jb9k_.
(The format of our PDB-style files is described here.)

Timeline for d3jb9k_:

  • d3jb9k_ is new in SCOPe 2.07-stable