Lineage for d3jb9y2 (3jb9 Y:172-289)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2516578Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2518968Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 2518969Family d.58.7.1: Canonical RBD [54929] (70 proteins)
    Pfam PF00076
    Pfam PF13893
  6. 2519195Protein Pre-mRNA splicing factor Cwc2 / Cwf2 / Prp3, RRM domain [346093] (2 species)
  7. 2519201Species Schizosaccharomyces pombe 972h- [TaxId:284812] [346357] (1 PDB entry)
  8. 2519202Domain d3jb9y2: 3jb9 Y:172-289 [344828]
    Other proteins in same PDB: d3jb9a1, d3jb9a2, d3jb9a3, d3jb9a4, d3jb9a5, d3jb9b1, d3jb9b2, d3jb9b3, d3jb9b4, d3jb9b5, d3jb9c_, d3jb9e_, d3jb9f_, d3jb9g_, d3jb9h_, d3jb9i_, d3jb9j_, d3jb9k_, d3jb9l_, d3jb9m_, d3jb9r_, d3jb9s1, d3jb9s2, d3jb9t1, d3jb9t2, d3jb9u1, d3jb9u2, d3jb9u3, d3jb9v1, d3jb9v2, d3jb9w_, d3jb9x1, d3jb9x2, d3jb9x3, d3jb9x4, d3jb9y1, d3jb9z_
    protein/RNA complex; complexed with adp, gdp, mg, zn

Details for d3jb9y2

PDB Entry: 3jb9 (more details), 3.6 Å

PDB Description: cryo-em structure of the yeast spliceosome at 3.6 angstrom resolution
PDB Compounds: (Y:) Pre-mRNA-splicing factor cwf2

SCOPe Domain Sequences for d3jb9y2:

Sequence, based on SEQRES records: (download)

>d3jb9y2 d.58.7.1 (Y:172-289) Pre-mRNA splicing factor Cwc2 / Cwf2 / Prp3, RRM domain {Schizosaccharomyces pombe 972h- [TaxId: 284812]}
qnytlyvggitptddieeivsrhfaewgdierirvlnsrgiafitylneanaqfakeama
hqsldhdeclnvrwattdpnpasqarnqrrleeraanavkkllpkqflldleetkngk

Sequence, based on observed residues (ATOM records): (download)

>d3jb9y2 d.58.7.1 (Y:172-289) Pre-mRNA splicing factor Cwc2 / Cwf2 / Prp3, RRM domain {Schizosaccharomyces pombe 972h- [TaxId: 284812]}
qnytlyvggitptddieeivsrhfaewgdierirvlnsrgiafitylneanaqfakeama
hqsleclnvrwattdpnpasqarnqrrleeraanavkkllpkqflldleetkngk

SCOPe Domain Coordinates for d3jb9y2:

Click to download the PDB-style file with coordinates for d3jb9y2.
(The format of our PDB-style files is described here.)

Timeline for d3jb9y2:

  • d3jb9y2 is new in SCOPe 2.07-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d3jb9y1