Lineage for d3jb9a3 (3jb9 A:823-1604)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2571153Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 2571154Superfamily e.8.1: DNA/RNA polymerases [56672] (8 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 2572842Family e.8.1.8: Splicing factor Prp8 RT domain [345981] (2 proteins)
    Pfam PF10598, Pfam PF10597. Includes linker domain discussed in PubMed 23354046
    Homology to retroviral RT domains discussed in PubMed 21441348
  6. 2572843Protein Pre-mRNA splicing factor 8, Prp8 / Spp42 [346115] (2 species)
  7. 2572846Species Schizosaccharomyces pombe 972h- [TaxId:284812] [346407] (1 PDB entry)
  8. 2572847Domain d3jb9a3: 3jb9 A:823-1604 [344794]
    Other proteins in same PDB: d3jb9a1, d3jb9a2, d3jb9a4, d3jb9a5, d3jb9b1, d3jb9b2, d3jb9b3, d3jb9b4, d3jb9b5, d3jb9c_, d3jb9e_, d3jb9f_, d3jb9g_, d3jb9h_, d3jb9i_, d3jb9j_, d3jb9k_, d3jb9l_, d3jb9m_, d3jb9r_, d3jb9s1, d3jb9s2, d3jb9t1, d3jb9t2, d3jb9u1, d3jb9u2, d3jb9u3, d3jb9v1, d3jb9v2, d3jb9w_, d3jb9x1, d3jb9x2, d3jb9x3, d3jb9x4, d3jb9y1, d3jb9y2, d3jb9z_
    protein/RNA complex; complexed with adp, gdp, mg, zn

Details for d3jb9a3

PDB Entry: 3jb9 (more details), 3.6 Å

PDB Description: cryo-em structure of the yeast spliceosome at 3.6 angstrom resolution
PDB Compounds: (A:) Pre-mRNA-splicing factor spp42

SCOPe Domain Sequences for d3jb9a3:

Sequence, based on SEQRES records: (download)

>d3jb9a3 e.8.1.8 (A:823-1604) Pre-mRNA splicing factor 8, Prp8 / Spp42 {Schizosaccharomyces pombe 972h- [TaxId: 284812]}
yvtadeavaiyttfvhwlesrrfqpipfpplsykhdtkllvlalerlkeaysvkgrlnqs
qreelalveqaydnphemlsqikrrlltmrtfkevgiefmdmyshlipvysvdpmekicd
ayldqylwfeadrrhlfpswvkpsdsepppllvykwcqginnltdvwetsngecnvlmet
rlskvfekvdltllnrlmsllmdtnlasyasaknnvvlsykdmshtnsyglvrglqfssf
iwqfyglvldllilglqrateiagpadapndflhfkdqatetshpirlytryidkvyimf
rftdeesrdliqrflnenpdptnsnvvnyskgkkncwprdarmrlmkhdvnlgravfwei
rnrlprslttlewedtfpsvyskdnpnllfsmtgfevrilpkirqneefslkdgvwnltd
nrtkqrtaqafirvtedginqfgnrirqilmssgsttftkiankwntalialmtyyreaa
istpelldllvkceskiqtrvkislnskmpsrfppavfyspkelgglgmlsmghvlipqs
dlrwskqtdtgithfrsgmttngehlipnlyryiqpwesefidsqrvwaeyamkrqealq
qnrrltledledswdrgiprintlfqkdrhtlaydkgwrvrtefkqyqllknnpfwwtsq
rhdgklwqlnnyrvdviqalggvegilehtmfkatgfpsweglfwekasgfeesmkfkkl
tnaqrsglnqipnrrftlwwsptinranvyvgfqvqldltgimmhgkiptlkisliqifr
sh

Sequence, based on observed residues (ATOM records): (download)

>d3jb9a3 e.8.1.8 (A:823-1604) Pre-mRNA splicing factor 8, Prp8 / Spp42 {Schizosaccharomyces pombe 972h- [TaxId: 284812]}
yvtadeavaiyttfvhwlesrrfqpipfpplsykhdtkllvlalerlkeaysvkgrlnqs
qreelalveqaydnphemlsqikrrlltmrtfkevgiefmdmyshlipvysvdpmekicd
ayldqylwfeadrrhlfpswvkpsdsepppllvykwcqginnltdvwetsngecnvlmet
rlskvfekvdltllnrlmsllmdtnlasyasaknnvvlsykdmshtnsyglvrglqfssf
iwqfyglvldllilglqrateiagpadapndflhfkdqatetshpirlytryidkvyimf
rftdeesrdliqrflnenpdptnsnvvnyskgkkncwprdarmrlmkhdvnlgravfwei
rnrlprslttlewedtfpsvyskdnpnllfsmtgfevrilpkirqneefslkdgvwnltd
nrtkqrtaqafirvtedginqfgnrirqilmssgsttftkiankwntalialmtyyreaa
istpelldllvkceskiqtrvkislnskmpsrfppavfyspkelgglgmlsmghvlipqs
dlrwskqtdtgithfrsgmttngehlipnlyryiqpwesefidsqrvwaeyamkrqealq
qnrrltledledswdrgiprintlfqkdrhtlaydkgwrvrtefkqyqllknnpfwwtsq
rhdgklwqlnnyrvdviqalggvegilehtmfkatgfpsweglfwekasgfkkltnaqrs
glnqipnrrftlwwsptinranvyvgfqvqldltgimmhgkiptlkisliqifrsh

SCOPe Domain Coordinates for d3jb9a3:

Click to download the PDB-style file with coordinates for d3jb9a3.
(The format of our PDB-style files is described here.)

Timeline for d3jb9a3:

  • d3jb9a3 is new in SCOPe 2.07-stable