Lineage for d3jb9w_ (3jb9 W:)

  1. Root: SCOPe 2.07
  2. 2596047Class j: Peptides [58231] (148 folds)
  3. Fold j.138: Pre-mRNA splicing factor Cdc5-like [345902] (1 superfamily)
    Extended helical fragments, mostly disordered
  4. Superfamily j.138.1: Pre-mRNA splicing factor Cdc5-like [345938] (1 family) (S)
  5. Family j.138.1.1: Pre-mRNA splicing factor Cdc5-like [345996] (1 protein)
  6. Protein Pre-mRNA splicing factor Cdc5 [346139] (1 species)
  7. Species Schizosaccharomyces pombe 972h- [TaxId:284812] [346455] (1 PDB entry)
  8. 2598071Domain d3jb9w_: 3jb9 W: [344822]
    Other proteins in same PDB: d3jb9a1, d3jb9a2, d3jb9a3, d3jb9a4, d3jb9a5, d3jb9b1, d3jb9b2, d3jb9b3, d3jb9b4, d3jb9b5, d3jb9c_, d3jb9e_, d3jb9f_, d3jb9g_, d3jb9h_, d3jb9i_, d3jb9j_, d3jb9k_, d3jb9l_, d3jb9m_, d3jb9r_, d3jb9s1, d3jb9s2, d3jb9t1, d3jb9t2, d3jb9u1, d3jb9u2, d3jb9u3, d3jb9v1, d3jb9v2, d3jb9x1, d3jb9x2, d3jb9x3, d3jb9x4, d3jb9y1, d3jb9y2, d3jb9z_
    protein/RNA complex; complexed with adp, gdp, mg, zn

Details for d3jb9w_

PDB Entry: 3jb9 (more details), 3.6 Å

PDB Description: cryo-em structure of the yeast spliceosome at 3.6 angstrom resolution
PDB Compounds: (W:) Pre-mRNA-splicing factor cdc5

SCOPe Domain Sequences for d3jb9w_:

Sequence, based on SEQRES records: (download)

>d3jb9w_ j.138.1.1 (W:) Pre-mRNA splicing factor Cdc5 {Schizosaccharomyces pombe 972h- [TaxId: 284812]}
awkntedeilkaavskygknqwarissllvrktpkqckarwyewidpsikktewsreede
kllhlakllptqwrtiapivgrtatqcleryqkllddleakeneqlglisgegaeaaapv
ndpnsrlrfgeaepnletlpalpdaidmdedekemlseararlantqgkkakrkdrekql
eltrrlshlqkrrelkaaginiklfrrkknemdynasipfekkpaigfyxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxaaekfytndiqrdlak
kalecnklenrvydlvrssyeqrnflikkishawkalqterknltcyeflynqerlalpn
rleaaeielskmqqieayaqqdyarvtgqn

Sequence, based on observed residues (ATOM records): (download)

>d3jb9w_ j.138.1.1 (W:) Pre-mRNA splicing factor Cdc5 {Schizosaccharomyces pombe 972h- [TaxId: 284812]}
awkntedeilkaavskygknqwarissllvrktpkqckarwyewidpsikktewsreede
kllhlakllptqwrtiapivgrtatqcleryqkllddleakedmdedekemlseararla
ntqgkkakrkdrekqleltrrlshlqkrrelkynasipfekkpaigfyxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxaaekfytndiqrdlakkalecnklenrvydlvrssyeqrn
flikkishawkalqterknltcyeflynqerlalpnrleaaeielskmqqieayaqqdya
rvtgqn

SCOPe Domain Coordinates for d3jb9w_:

Click to download the PDB-style file with coordinates for d3jb9w_.
(The format of our PDB-style files is described here.)

Timeline for d3jb9w_:

  • d3jb9w_ is new in SCOPe 2.07-stable