Lineage for d3jb9e_ (3jb9 e:)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2590031Fold g.99: Pre-mRNA splicing factor Cwf14-like [345897] (1 superfamily)
    9 conserved Cys bind 3 zinc. Also includes N-terminal helical bundle
  4. 2590032Superfamily g.99.1: Pre-mRNA splicing factor Cwf14-like [345930] (1 family) (S)
    Pfam PF01125
  5. 2590033Family g.99.1.1: Pre-mRNA splicing factor Cwf14-like [345988] (2 proteins)
  6. 2590034Protein Pre-mRNA splicing factor Cwf14 / Bud31 [346129] (2 species)
  7. 2590037Species Schizosaccharomyces pombe 972h- [TaxId:284812] [346441] (1 PDB entry)
  8. 2590038Domain d3jb9e_: 3jb9 e: [344803]
    Other proteins in same PDB: d3jb9a1, d3jb9a2, d3jb9a3, d3jb9a4, d3jb9a5, d3jb9b1, d3jb9b2, d3jb9b3, d3jb9b4, d3jb9b5, d3jb9c_, d3jb9f_, d3jb9g_, d3jb9h_, d3jb9i_, d3jb9j_, d3jb9k_, d3jb9l_, d3jb9m_, d3jb9r_, d3jb9s1, d3jb9s2, d3jb9t1, d3jb9t2, d3jb9u1, d3jb9u2, d3jb9u3, d3jb9v1, d3jb9v2, d3jb9w_, d3jb9x1, d3jb9x2, d3jb9x3, d3jb9x4, d3jb9y1, d3jb9y2, d3jb9z_
    protein/RNA complex; complexed with adp, gdp, mg, zn

Details for d3jb9e_

PDB Entry: 3jb9 (more details), 3.6 Å

PDB Description: cryo-em structure of the yeast spliceosome at 3.6 angstrom resolution
PDB Compounds: (e:) Pre-mRNA-splicing factor cwf14

SCOPe Domain Sequences for d3jb9e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3jb9e_ g.99.1.1 (e:) Pre-mRNA splicing factor Cwf14 / Bud31 {Schizosaccharomyces pombe 972h- [TaxId: 284812]}
rlrtsrtkrppdgfdeieptliefqdrmrqientmgkgtktemlapifqlhhqrsryiyd
lyykreaistelynwllkqnyadgnliakwkkpgyeklcclrciqtaeskfgstcicrvp
kskldkdqrvrcthcgcngcascd

SCOPe Domain Coordinates for d3jb9e_:

Click to download the PDB-style file with coordinates for d3jb9e_.
(The format of our PDB-style files is described here.)

Timeline for d3jb9e_:

  • d3jb9e_ is new in SCOPe 2.07-stable