Lineage for d3jb9x2 (3jb9 X:7-383)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332674Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2332675Superfamily a.118.1: ARM repeat [48371] (27 families) (S)
  5. 2333288Family a.118.1.29: Pre-mRNA splicing factor Cwf11 N-terminal domain-like [345955] (1 protein)
    N-terminal part of Pfam PF16399; contains ARM repeats and several extra helices
  6. 2333289Protein Pre-mRNA splicing factor Cwf11 / Aquarius [346026] (2 species)
  7. 2333292Species Schizosaccharomyces pombe 972h- [TaxId:284812] [346187] (1 PDB entry)
  8. 2333293Domain d3jb9x2: 3jb9 X:7-383 [344824]
    Other proteins in same PDB: d3jb9a1, d3jb9a2, d3jb9a3, d3jb9a4, d3jb9a5, d3jb9b1, d3jb9b2, d3jb9b3, d3jb9b4, d3jb9b5, d3jb9c_, d3jb9e_, d3jb9f_, d3jb9g_, d3jb9h_, d3jb9i_, d3jb9j_, d3jb9k_, d3jb9l_, d3jb9m_, d3jb9r_, d3jb9s1, d3jb9s2, d3jb9t1, d3jb9t2, d3jb9u1, d3jb9u2, d3jb9u3, d3jb9v1, d3jb9v2, d3jb9w_, d3jb9x1, d3jb9x3, d3jb9x4, d3jb9y1, d3jb9y2, d3jb9z_
    protein/RNA complex; complexed with adp, gdp, mg, zn

Details for d3jb9x2

PDB Entry: 3jb9 (more details), 3.6 Å

PDB Description: cryo-em structure of the yeast spliceosome at 3.6 angstrom resolution
PDB Compounds: (X:) Pre-mRNA-splicing factor cwf11

SCOPe Domain Sequences for d3jb9x2:

Sequence, based on SEQRES records: (download)

>d3jb9x2 a.118.1.29 (X:7-383) Pre-mRNA splicing factor Cwf11 / Aquarius {Schizosaccharomyces pombe 972h- [TaxId: 284812]}
kkkqiinyansnwgqnegvefqetmlqcileavivskdakqvlsllhelklfenflwqrv
ntemslnhinltcmlllykskyeyitwdlidenrfqlffekvievslslnlsevvymiqf
itlcfqfsnieklrklvyqltnisilnsldnldkvkyllhdsssltkafdsykekrpsiv
ekfplhnllsrwihslliksisyaqtekqeakvtpllaiinmslvllsafptrrfahpvi
edscfytalrmslyydsnelfkkmtddlnyvlkfpfdntrgneyekeqkirndelvyyhl
qltlfsdfqkelgdlvfctqtslqqrqkleeitsflsfnslkslcskcylrtsfpekyai
kvdfeflknvfintydr

Sequence, based on observed residues (ATOM records): (download)

>d3jb9x2 a.118.1.29 (X:7-383) Pre-mRNA splicing factor Cwf11 / Aquarius {Schizosaccharomyces pombe 972h- [TaxId: 284812]}
kkkqiinyansnwgegvefqetmlqcileavivsakqvlsllhelklfenflwqrvntem
slnhinltcmlllykskyeyitwdlinrfqlffekvievslslnlsevvymiqfitlcfq
fsnieklrklvyqltnisilnslldkvkyllhdsssltkafdsykekrpvekfplhnlls
rwihslliksisyaqkqeakvtpllaiinmslvllsafptrrfahpviedscfytalrms
lyydsnelfkkmtddlnyvlkfpfdntrgneyekeqkirndelvyyhlqltlfsdfqlqq
rqkleeitsflsfnslkslcskcylrtsfpekyaikvdfeflknvfintydr

SCOPe Domain Coordinates for d3jb9x2:

Click to download the PDB-style file with coordinates for d3jb9x2.
(The format of our PDB-style files is described here.)

Timeline for d3jb9x2:

  • d3jb9x2 is new in SCOPe 2.07-stable