Lineage for d3jb9u1 (3jb9 U:1-57)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3037528Fold g.44: RING/U-box [57849] (1 superfamily)
    dimetal(zinc)-bound alpha+beta motif; structurally diverse
  4. 3037529Superfamily g.44.1: RING/U-box [57850] (7 families) (S)
  5. 3037595Family g.44.1.2: U-box [90222] (5 proteins)
    Associated with multi-ubiquitination; lacks the RING-domain metal ion-binding residues
  6. 3037599Protein Pre-mRNA splicing factor Prp19 [90223] (2 species)
  7. 3037602Species Schizosaccharomyces pombe 972h- [TaxId:284812] [346436] (1 PDB entry)
  8. 3037605Domain d3jb9u1: 3jb9 U:1-57 [344817]
    Other proteins in same PDB: d3jb9a1, d3jb9a2, d3jb9a3, d3jb9a4, d3jb9a5, d3jb9b1, d3jb9b2, d3jb9b3, d3jb9b4, d3jb9b5, d3jb9c_, d3jb9e_, d3jb9f_, d3jb9g_, d3jb9h_, d3jb9i_, d3jb9j_, d3jb9k_, d3jb9l_, d3jb9m_, d3jb9r_, d3jb9s2, d3jb9t2, d3jb9u2, d3jb9u3, d3jb9v2, d3jb9w_, d3jb9x1, d3jb9x2, d3jb9x3, d3jb9x4, d3jb9y1, d3jb9y2, d3jb9z_
    protein/RNA complex; complexed with adp, gdp, mg, zn

Details for d3jb9u1

PDB Entry: 3jb9 (more details), 3.6 Å

PDB Description: cryo-em structure of the yeast spliceosome at 3.6 angstrom resolution
PDB Compounds: (U:) Pre-mRNA-processing factor 19

SCOPe Domain Sequences for d3jb9u1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3jb9u1 g.44.1.2 (U:1-57) Pre-mRNA splicing factor Prp19 {Schizosaccharomyces pombe 972h- [TaxId: 284812]}
mfcsisgetpkepvisrvsgnvyekrlieqviretskdpvtqqectledlvpvkvpd

SCOPe Domain Coordinates for d3jb9u1:

Click to download the PDB-style file with coordinates for d3jb9u1.
(The format of our PDB-style files is described here.)

Timeline for d3jb9u1: