Lineage for d3jb9g_ (3jb9 g:)

  1. Root: SCOPe 2.08
  2. 3045664Class j: Peptides [58231] (151 folds)
  3. 3047698Fold j.139: Pre-mRNA splicing factor Prp17-like [345903] (1 superfamily)
    Extended fragments made of helices and loops
  4. 3047699Superfamily j.139.1: Pre-mRNA splicing factor Prp17-like [345939] (1 family) (S)
  5. 3047700Family j.139.1.1: Pre-mRNA splicing factor Prp17-like [345997] (1 protein)
  6. 3047701Protein Pre-mRNA splicing factor Prp17, extended domain [346140] (2 species)
  7. 3047704Species Schizosaccharomyces pombe 972h- [TaxId:284812] [346457] (1 PDB entry)
  8. 3047705Domain d3jb9g_: 3jb9 g: [344805]
    Other proteins in same PDB: d3jb9a1, d3jb9a2, d3jb9a3, d3jb9a4, d3jb9a5, d3jb9b1, d3jb9b2, d3jb9b3, d3jb9b4, d3jb9b5, d3jb9c_, d3jb9e_, d3jb9f_, d3jb9h_, d3jb9i_, d3jb9j_, d3jb9k_, d3jb9l_, d3jb9m_, d3jb9r_, d3jb9s1, d3jb9s2, d3jb9t1, d3jb9t2, d3jb9u1, d3jb9u2, d3jb9u3, d3jb9v1, d3jb9v2, d3jb9w_, d3jb9x1, d3jb9x2, d3jb9x3, d3jb9x4, d3jb9y1, d3jb9y2, d3jb9z_
    protein/RNA complex; complexed with adp, gdp, mg, zn

Details for d3jb9g_

PDB Entry: 3jb9 (more details), 3.6 Å

PDB Description: cryo-em structure of the yeast spliceosome at 3.6 angstrom resolution
PDB Compounds: (g:) Pre-mRNA-processing factor 17

SCOPe Domain Sequences for d3jb9g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3jb9g_ j.139.1.1 (g:) Pre-mRNA splicing factor Prp17, extended domain {Schizosaccharomyces pombe 972h- [TaxId: 284812]}
ensqspniqpllhtenlapavvdnvkddlivskggnsrelarnvpvnemvqpalgpanpf
vtkeqdsiknsitgyaereyvpnfvfnqeyyanthaiygkrnfddneattstdlkrksqk
ikerredpgdpsilegdgaykgpwagyg

SCOPe Domain Coordinates for d3jb9g_:

Click to download the PDB-style file with coordinates for d3jb9g_.
(The format of our PDB-style files is described here.)

Timeline for d3jb9g_: