Lineage for d3jb9c_ (3jb9 c:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2499927Fold d.13: HIT-like [54196] (2 superfamilies)
    alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha
  4. 2499928Superfamily d.13.1: HIT-like [54197] (6 families) (S)
  5. 2500173Family d.13.1.5: Pre-mRNA splicing factor Cwf19-like [345971] (1 protein)
    Pfam PF04677, Pfam PF04676. Contains additional N-terminal helices
  6. 2500174Protein Pre-mRNA splicing factor Cwf19 [346091] (1 species)
  7. 2500175Species Schizosaccharomyces pombe 972h- [TaxId:284812] [346350] (1 PDB entry)
  8. 2500176Domain d3jb9c_: 3jb9 c: [344802]
    Other proteins in same PDB: d3jb9a1, d3jb9a2, d3jb9a3, d3jb9a4, d3jb9a5, d3jb9b1, d3jb9b2, d3jb9b3, d3jb9b4, d3jb9b5, d3jb9e_, d3jb9f_, d3jb9g_, d3jb9h_, d3jb9i_, d3jb9j_, d3jb9k_, d3jb9l_, d3jb9m_, d3jb9r_, d3jb9s1, d3jb9s2, d3jb9t1, d3jb9t2, d3jb9u1, d3jb9u2, d3jb9u3, d3jb9v1, d3jb9v2, d3jb9w_, d3jb9x1, d3jb9x2, d3jb9x3, d3jb9x4, d3jb9y1, d3jb9y2, d3jb9z_
    protein/RNA complex; complexed with adp, gdp, mg, zn

Details for d3jb9c_

PDB Entry: 3jb9 (more details), 3.6 Å

PDB Description: cryo-em structure of the yeast spliceosome at 3.6 angstrom resolution
PDB Compounds: (c:) Pre-mRNA-splicing factor cwf19

SCOPe Domain Sequences for d3jb9c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3jb9c_ d.13.1.5 (c:) Pre-mRNA splicing factor Cwf19 {Schizosaccharomyces pombe 972h- [TaxId: 284812]}
ptidemvqeekllnkqrkygqnyeyakqiakdktysnnldyldenagklsnrmkrgdvsl
aqissggdlkkinhvldtcplclnyetqplapvislshrayvslptqpelakyhclivpt
ghrintlscdedewdeirnfmkcialmfdsmnlgvifyenapspqrymhtaiecipvskr
ilslapayfrealstsdeewsqhrkiidtlegskkygkwafrkmmvkelgyfhvwfsidg
gyghvvedekawgrhdqvprqvfasmlnlppevirrkgswtgkkdpredmfrsrfekfdw

SCOPe Domain Coordinates for d3jb9c_:

Click to download the PDB-style file with coordinates for d3jb9c_.
(The format of our PDB-style files is described here.)

Timeline for d3jb9c_:

  • d3jb9c_ is new in SCOPe 2.07-stable