SCOPe 2.08: Domain d2hg4f7: 2hg4 F:870-901

Lineage for d2hg4f7 (2hg4 F:870-901)

1. Root: SCOPe 2.08

2. Class j: Peptides [58231] (151 folds)

3. Fold j.134: C-terminal linker of 6-deoxyerythronolide B synthase (DEBS)-like [310563] (1 superfamily)
   long peptide binds to AT, KS-to-AT, and KS domains of DEBS

4. Superfamily j.134.1: C-terminal linker of 6-deoxyerythronolide B synthase (DEBS)-like [310591] (1 family)

5. Family j.134.1.1: C-terminal linker of 6-deoxyerythronolide B synthase (DEBS)-like [310638] (2 proteins)

6. Protein C-terminal linker of 6-deoxyerythronolide B synthase (DEBS) [310775] (1 species)

7. Species Saccharopolyspora erythraea [TaxId:1836] [311031] (1 PDB entry)

8. Domain d2hg4f7: 2hg4 F:870-901 [304010]
   Other proteins in same PDB: d2hg4a1, d2hg4a2, d2hg4a3, d2hg4a4, d2hg4a5, d2hg4a6, d2hg4b1, d2hg4b2, d2hg4b3, d2hg4b4, d2hg4b5, d2hg4b6, d2hg4c1, d2hg4c2, d2hg4c3, d2hg4c4, d2hg4c5, d2hg4c6, d2hg4d1, d2hg4d2, d2hg4d3, d2hg4d4, d2hg4d5, d2hg4d6, d2hg4e1, d2hg4e2, d2hg4e3, d2hg4e4, d2hg4e5, d2hg4e6, d2hg4f1, d2hg4f2, d2hg4f3, d2hg4f4, d2hg4f5, d2hg4f6
   complexed with act, cl, so4

Details for d2hg4f7

PDB Entry: 2hg4, 2.73 Å

PDB Description: Structure of the ketosynthase-acyltransferase didomain of module 5 from DEBS.

PDB Compounds: (F:) 6-Deoxyerythronolide B Synthase

SCOPe Domain Sequences for d2hg4f7:

Sequence; same for both SEQRES and ATOM records:

>d2hg4f7 j.134.1.1 (F:870-901) C-terminal linker of 6-deoxyerythronolide B synthase (DEBS) {Saccharopolyspora erythraea [TaxId: 1836]}
gvevdwspafadarpvelpvypfqrqrywlpi

Timeline for d2hg4f7:

• d2hg4f7 first appeared in SCOPe 2.06
  
• d2hg4f7 appears in SCOPe 2.07