Lineage for d2hg4f6 (2hg4 F:550-677,F:742-869)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855172Fold c.19: FabD/lysophospholipase-like [52150] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 432156; strand 4 is antiparallel to the rest
  4. 2855173Superfamily c.19.1: FabD/lysophospholipase-like [52151] (3 families) (S)
  5. 2855174Family c.19.1.1: FabD-like [52152] (4 proteins)
    the superfamily common core covers almost all of the family fold
  6. 2855175Protein Catalytic domain from acyl transferase (AT) domain of 6-deoxyerythronolide B synthase (DEBS) [310773] (1 species)
  7. 2855176Species Saccharopolyspora erythraea [TaxId:1836] [311029] (1 PDB entry)
  8. 2855182Domain d2hg4f6: 2hg4 F:550-677,F:742-869 [304009]
    Other proteins in same PDB: d2hg4a1, d2hg4a2, d2hg4a3, d2hg4a4, d2hg4a5, d2hg4a7, d2hg4b1, d2hg4b2, d2hg4b3, d2hg4b4, d2hg4b5, d2hg4b7, d2hg4c1, d2hg4c2, d2hg4c3, d2hg4c4, d2hg4c5, d2hg4c7, d2hg4d1, d2hg4d2, d2hg4d3, d2hg4d4, d2hg4d5, d2hg4d7, d2hg4e1, d2hg4e2, d2hg4e3, d2hg4e4, d2hg4e5, d2hg4e7, d2hg4f1, d2hg4f2, d2hg4f3, d2hg4f4, d2hg4f5, d2hg4f7
    complexed with act, cl, so4

Details for d2hg4f6

PDB Entry: 2hg4 (more details), 2.73 Å

PDB Description: Structure of the ketosynthase-acyltransferase didomain of module 5 from DEBS.
PDB Compounds: (F:) 6-Deoxyerythronolide B Synthase

SCOPe Domain Sequences for d2hg4f6:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hg4f6 c.19.1.1 (F:550-677,F:742-869) Catalytic domain from acyl transferase (AT) domain of 6-deoxyerythronolide B synthase (DEBS) {Saccharopolyspora erythraea [TaxId: 1836]}
rrgvamvfpgqgaqwqgmardllresqvfadsirdceralaphvdwsltdllsgarpldr
vdvvqpalfavmvslaalwrshgvepaavvghsqgeiaaahvagaltledaaklvavrsr
vlrrlggqXyashspqveslreelltelagispvsadvalystttgqpidtatmdtaywy
anlreqvrfqdatrqlaeagfdafvevsphpvltvgieatldsalpadagacvvgtlrrd
rggladfhtalgeayaq

SCOPe Domain Coordinates for d2hg4f6:

Click to download the PDB-style file with coordinates for d2hg4f6.
(The format of our PDB-style files is described here.)

Timeline for d2hg4f6: