SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2hg4a2 (2hg4 A:37-275)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2146372Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2146373Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2146374Family c.95.1.1: Thiolase-related [53902] (10 protein domains)
  6. 2146768Protein Ketosynthase domain from 6-deoxyerythronolide B synthase (DEBS) [310768] (1 species)
  7. 2146769Species Saccharopolyspora erythraea [TaxId:1836] [311024] (1 PDB entry)
  8. 2146770Domain d2hg4a2: 2hg4 A:37-275 [303970]
    Other proteins in same PDB: d2hg4a1, d2hg4a4, d2hg4a5, d2hg4a6, d2hg4a7, d2hg4b1, d2hg4b4, d2hg4b5, d2hg4b6, d2hg4b7, d2hg4c1, d2hg4c4, d2hg4c5, d2hg4c6, d2hg4c7, d2hg4d1, d2hg4d4, d2hg4d5, d2hg4d6, d2hg4d7, d2hg4e1, d2hg4e4, d2hg4e5, d2hg4e6, d2hg4e7, d2hg4f1, d2hg4f4, d2hg4f5, d2hg4f6, d2hg4f7
    complexed with act, cl, so4

Details for d2hg4a2

PDB Entry: 2hg4 (more details), 2.73 Å

PDB Description: Structure of the ketosynthase-acyltransferase didomain of module 5 from DEBS.
PDB Compounds: (A:) 6-Deoxyerythronolide B Synthase

SCOPe Domain Sequences for d2hg4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hg4a2 c.95.1.1 (A:37-275) Ketosynthase domain from 6-deoxyerythronolide B synthase (DEBS) {Saccharopolyspora erythraea [TaxId: 1836]}
agepiaivgmacrfpgdvdspesfwefvsgggdaiaeapadrgwepdpdarlggmlaaag
dfdagffgisprealamdpqqrimleiswealeraghdpvslrgsatgvftgvgtvdygp
rpdeapdevlgyvgtgtassvasgrvayclglegpamtvdtacssgltalhlameslrrd
ecglalaggvtvmsspgaftefrsqgglaadgrckpfskaadgfglaegagvlvlqrls

SCOPe Domain Coordinates for d2hg4a2:

Click to download the PDB-style file with coordinates for d2hg4a2.
(The format of our PDB-style files is described here.)

Timeline for d2hg4a2:

  • d2hg4a2 is new in SCOPe 2.06-stable