Lineage for d2hg4c3 (2hg4 C:276-457)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2488301Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2488302Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2488303Family c.95.1.1: Thiolase-related [53902] (10 proteins)
  6. 2488697Protein Ketosynthase domain from 6-deoxyerythronolide B synthase (DEBS) [310768] (1 species)
  7. 2488698Species Saccharopolyspora erythraea [TaxId:1836] [311024] (1 PDB entry)
  8. 2488704Domain d2hg4c3: 2hg4 C:276-457 [303985]
    Other proteins in same PDB: d2hg4a1, d2hg4a4, d2hg4a5, d2hg4a6, d2hg4a7, d2hg4b1, d2hg4b4, d2hg4b5, d2hg4b6, d2hg4b7, d2hg4c1, d2hg4c4, d2hg4c5, d2hg4c6, d2hg4c7, d2hg4d1, d2hg4d4, d2hg4d5, d2hg4d6, d2hg4d7, d2hg4e1, d2hg4e4, d2hg4e5, d2hg4e6, d2hg4e7, d2hg4f1, d2hg4f4, d2hg4f5, d2hg4f6, d2hg4f7
    complexed with act, cl, so4

Details for d2hg4c3

PDB Entry: 2hg4 (more details), 2.73 Å

PDB Description: Structure of the ketosynthase-acyltransferase didomain of module 5 from DEBS.
PDB Compounds: (C:) 6-Deoxyerythronolide B Synthase

SCOPe Domain Sequences for d2hg4c3:

Sequence, based on SEQRES records: (download)

>d2hg4c3 c.95.1.1 (C:276-457) Ketosynthase domain from 6-deoxyerythronolide B synthase (DEBS) {Saccharopolyspora erythraea [TaxId: 1836]}
aarregrpvlavlrgsavnqdgasngltapsgpaqqrvirralenagvragdvdyveahg
tgtrlgdpievhallstygaerdpddplwigsvksnightqaaagvagvmkavlalrhge
mprtlhfdepspqiewdlgavsvvsqarswpagerprragvssfgisgtnahviveeape
ad

Sequence, based on observed residues (ATOM records): (download)

>d2hg4c3 c.95.1.1 (C:276-457) Ketosynthase domain from 6-deoxyerythronolide B synthase (DEBS) {Saccharopolyspora erythraea [TaxId: 1836]}
aarregrpvlavlrgsavnqdgasngltapsgpaqqrvirralenagvragdvdyveahg
tgtrlgdpievhallstygaerdpddplwigsvksnightqaaagvagvmkavlalrhge
mprtlhfdepspqiewavsvvsqarswpagerprragvssfgisgtnahviveeapead

SCOPe Domain Coordinates for d2hg4c3:

Click to download the PDB-style file with coordinates for d2hg4c3.
(The format of our PDB-style files is described here.)

Timeline for d2hg4c3: