Lineage for d2hg4a7 (2hg4 A:870-901)

  1. Root: SCOPe 2.06
  2. 2243222Class j: Peptides [58231] (133 folds)
  3. 2245199Fold j.134: C-terminal linker of 6-deoxyerythronolide B synthase (DEBS)-like [310563] (1 superfamily)
    long peptide binds to AT, KS-to-AT, and KS domains of DEBS
  4. 2245200Superfamily j.134.1: C-terminal linker of 6-deoxyerythronolide B synthase (DEBS)-like [310591] (1 family) (S)
  5. 2245201Family j.134.1.1: C-terminal linker of 6-deoxyerythronolide B synthase (DEBS)-like [310638] (2 protein domains)
  6. 2245202Protein C-terminal linker of 6-deoxyerythronolide B synthase (DEBS) [310775] (1 species)
  7. 2245203Species Saccharopolyspora erythraea [TaxId:1836] [311031] (1 PDB entry)
  8. 2245204Domain d2hg4a7: 2hg4 A:870-901 [303975]
    Other proteins in same PDB: d2hg4a1, d2hg4a2, d2hg4a3, d2hg4a4, d2hg4a5, d2hg4a6, d2hg4b1, d2hg4b2, d2hg4b3, d2hg4b4, d2hg4b5, d2hg4b6, d2hg4c1, d2hg4c2, d2hg4c3, d2hg4c4, d2hg4c5, d2hg4c6, d2hg4d1, d2hg4d2, d2hg4d3, d2hg4d4, d2hg4d5, d2hg4d6, d2hg4e1, d2hg4e2, d2hg4e3, d2hg4e4, d2hg4e5, d2hg4e6, d2hg4f1, d2hg4f2, d2hg4f3, d2hg4f4, d2hg4f5, d2hg4f6
    complexed with act, cl, so4

Details for d2hg4a7

PDB Entry: 2hg4 (more details), 2.73 Å

PDB Description: Structure of the ketosynthase-acyltransferase didomain of module 5 from DEBS.
PDB Compounds: (A:) 6-Deoxyerythronolide B Synthase

SCOPe Domain Sequences for d2hg4a7:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hg4a7 j.134.1.1 (A:870-901) C-terminal linker of 6-deoxyerythronolide B synthase (DEBS) {Saccharopolyspora erythraea [TaxId: 1836]}
gvevdwspafadarpvelpvypfqrqrywlpi

SCOPe Domain Coordinates for d2hg4a7:

Click to download the PDB-style file with coordinates for d2hg4a7.
(The format of our PDB-style files is described here.)

Timeline for d2hg4a7:

  • d2hg4a7 is new in SCOPe 2.06-stable