| Class j: Peptides [58231] (151 folds) |
| Fold j.134: C-terminal linker of 6-deoxyerythronolide B synthase (DEBS)-like [310563] (1 superfamily) long peptide binds to AT, KS-to-AT, and KS domains of DEBS |
Superfamily j.134.1: C-terminal linker of 6-deoxyerythronolide B synthase (DEBS)-like [310591] (1 family) ![]() |
| Family j.134.1.1: C-terminal linker of 6-deoxyerythronolide B synthase (DEBS)-like [310638] (2 proteins) |
| Protein C-terminal linker of 6-deoxyerythronolide B synthase (DEBS) [310775] (1 species) |
| Species Saccharopolyspora erythraea [TaxId:1836] [311031] (1 PDB entry) |
| Domain d2hg4c7: 2hg4 C:870-901 [303989] Other proteins in same PDB: d2hg4a1, d2hg4a2, d2hg4a3, d2hg4a4, d2hg4a5, d2hg4a6, d2hg4b1, d2hg4b2, d2hg4b3, d2hg4b4, d2hg4b5, d2hg4b6, d2hg4c1, d2hg4c2, d2hg4c3, d2hg4c4, d2hg4c5, d2hg4c6, d2hg4d1, d2hg4d2, d2hg4d3, d2hg4d4, d2hg4d5, d2hg4d6, d2hg4e1, d2hg4e2, d2hg4e3, d2hg4e4, d2hg4e5, d2hg4e6, d2hg4f1, d2hg4f2, d2hg4f3, d2hg4f4, d2hg4f5, d2hg4f6 complexed with act, cl, so4 |
PDB Entry: 2hg4 (more details), 2.73 Å
SCOPe Domain Sequences for d2hg4c7:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hg4c7 j.134.1.1 (C:870-901) C-terminal linker of 6-deoxyerythronolide B synthase (DEBS) {Saccharopolyspora erythraea [TaxId: 1836]}
gvevdwspafadarpvelpvypfqrqrywlpi
Timeline for d2hg4c7:
View in 3DDomains from other chains: (mouse over for more information) d2hg4a1, d2hg4a2, d2hg4a3, d2hg4a4, d2hg4a5, d2hg4a6, d2hg4a7, d2hg4b1, d2hg4b2, d2hg4b3, d2hg4b4, d2hg4b5, d2hg4b6, d2hg4b7, d2hg4d1, d2hg4d2, d2hg4d3, d2hg4d4, d2hg4d5, d2hg4d6, d2hg4d7, d2hg4e1, d2hg4e2, d2hg4e3, d2hg4e4, d2hg4e5, d2hg4e6, d2hg4e7, d2hg4f1, d2hg4f2, d2hg4f3, d2hg4f4, d2hg4f5, d2hg4f6, d2hg4f7 |