Lineage for d2hg4f4 (2hg4 F:466-549)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3012150Fold d.390: KS-to-AT linker domain from 6-deoxyerythronolide B synthase (DEBS)-like [310562] (1 superfamily)
    beta-alpha(2)-beta-alpha-beta; 2 layers; order 123
  4. 3012151Superfamily d.390.1: KS-to-AT linker domain from 6-deoxyerythronolide B synthase (DEBS)-like [310590] (1 family) (S)
    Pfam PF16197
  5. 3012152Family d.390.1.1: KS-to-AT linker domain from 6-deoxyerythronolide B synthase (DEBS)-like [310637] (2 proteins)
  6. 3012161Protein KS-to-AT linker domain from 6-deoxyerythronolide B synthase (DEBS) [310769] (1 species)
  7. 3012162Species Saccharopolyspora erythraea [TaxId:1836] [311025] (1 PDB entry)
  8. 3012168Domain d2hg4f4: 2hg4 F:466-549 [304007]
    Other proteins in same PDB: d2hg4a1, d2hg4a2, d2hg4a3, d2hg4a5, d2hg4a6, d2hg4a7, d2hg4b1, d2hg4b2, d2hg4b3, d2hg4b5, d2hg4b6, d2hg4b7, d2hg4c1, d2hg4c2, d2hg4c3, d2hg4c5, d2hg4c6, d2hg4c7, d2hg4d1, d2hg4d2, d2hg4d3, d2hg4d5, d2hg4d6, d2hg4d7, d2hg4e1, d2hg4e2, d2hg4e3, d2hg4e5, d2hg4e6, d2hg4e7, d2hg4f1, d2hg4f2, d2hg4f3, d2hg4f5, d2hg4f6, d2hg4f7
    complexed with act, cl, so4

Details for d2hg4f4

PDB Entry: 2hg4 (more details), 2.73 Å

PDB Description: Structure of the ketosynthase-acyltransferase didomain of module 5 from DEBS.
PDB Compounds: (F:) 6-Deoxyerythronolide B Synthase

SCOPe Domain Sequences for d2hg4f4:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hg4f4 d.390.1.1 (F:466-549) KS-to-AT linker domain from 6-deoxyerythronolide B synthase (DEBS) {Saccharopolyspora erythraea [TaxId: 1836]}
gpvplvlsgrdeqamraqagrladhlareprnslrdtgftlatrrsawehravvvgdrde
alaglravadgriadrtatgqart

SCOPe Domain Coordinates for d2hg4f4:

Click to download the PDB-style file with coordinates for d2hg4f4.
(The format of our PDB-style files is described here.)

Timeline for d2hg4f4: