| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.19: FabD/lysophospholipase-like [52150] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 432156; strand 4 is antiparallel to the rest |
Superfamily c.19.1: FabD/lysophospholipase-like [52151] (3 families) ![]() |
| Family c.19.1.1: FabD-like [52152] (4 proteins) the superfamily common core covers almost all of the family fold |
| Protein Catalytic domain from acyl transferase (AT) domain of 6-deoxyerythronolide B synthase (DEBS) [310773] (1 species) |
| Species Saccharopolyspora erythraea [TaxId:1836] [311029] (1 PDB entry) |
| Domain d2hg4a6: 2hg4 A:550-677,A:742-869 [303974] Other proteins in same PDB: d2hg4a1, d2hg4a2, d2hg4a3, d2hg4a4, d2hg4a5, d2hg4a7, d2hg4b1, d2hg4b2, d2hg4b3, d2hg4b4, d2hg4b5, d2hg4b7, d2hg4c1, d2hg4c2, d2hg4c3, d2hg4c4, d2hg4c5, d2hg4c7, d2hg4d1, d2hg4d2, d2hg4d3, d2hg4d4, d2hg4d5, d2hg4d7, d2hg4e1, d2hg4e2, d2hg4e3, d2hg4e4, d2hg4e5, d2hg4e7, d2hg4f1, d2hg4f2, d2hg4f3, d2hg4f4, d2hg4f5, d2hg4f7 complexed with act, cl, so4 |
PDB Entry: 2hg4 (more details), 2.73 Å
SCOPe Domain Sequences for d2hg4a6:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hg4a6 c.19.1.1 (A:550-677,A:742-869) Catalytic domain from acyl transferase (AT) domain of 6-deoxyerythronolide B synthase (DEBS) {Saccharopolyspora erythraea [TaxId: 1836]}
rrgvamvfpgqgaqwqgmardllresqvfadsirdceralaphvdwsltdllsgarpldr
vdvvqpalfavmvslaalwrshgvepaavvghsqgeiaaahvagaltledaaklvavrsr
vlrrlggqXyashspqveslreelltelagispvsadvalystttgqpidtatmdtaywy
anlreqvrfqdatrqlaeagfdafvevsphpvltvgieatldsalpadagacvvgtlrrd
rggladfhtalgeayaq
Timeline for d2hg4a6:
View in 3DDomains from other chains: (mouse over for more information) d2hg4b1, d2hg4b2, d2hg4b3, d2hg4b4, d2hg4b5, d2hg4b6, d2hg4b7, d2hg4c1, d2hg4c2, d2hg4c3, d2hg4c4, d2hg4c5, d2hg4c6, d2hg4c7, d2hg4d1, d2hg4d2, d2hg4d3, d2hg4d4, d2hg4d5, d2hg4d6, d2hg4d7, d2hg4e1, d2hg4e2, d2hg4e3, d2hg4e4, d2hg4e5, d2hg4e6, d2hg4e7, d2hg4f1, d2hg4f2, d2hg4f3, d2hg4f4, d2hg4f5, d2hg4f6, d2hg4f7 |