Lineage for d2hg4d3 (2hg4 D:276-457)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2916471Family c.95.1.1: Thiolase-related [53902] (20 proteins)
  6. 2916906Protein Ketosynthase domain from 6-deoxyerythronolide B synthase (DEBS), N-terminal domain [419024] (1 species)
  7. 2916907Species Saccharopolyspora erythraea [TaxId:1836] [419506] (1 PDB entry)
  8. 2916911Domain d2hg4d3: 2hg4 D:276-457 [303992]
    Other proteins in same PDB: d2hg4a1, d2hg4a2, d2hg4a4, d2hg4a5, d2hg4a6, d2hg4a7, d2hg4b1, d2hg4b2, d2hg4b4, d2hg4b5, d2hg4b6, d2hg4b7, d2hg4c1, d2hg4c2, d2hg4c4, d2hg4c5, d2hg4c6, d2hg4c7, d2hg4d1, d2hg4d2, d2hg4d4, d2hg4d5, d2hg4d6, d2hg4d7, d2hg4e1, d2hg4e2, d2hg4e4, d2hg4e5, d2hg4e6, d2hg4e7, d2hg4f1, d2hg4f2, d2hg4f4, d2hg4f5, d2hg4f6, d2hg4f7
    complexed with act, cl, so4
    has additional insertions and/or extensions that are not grouped together

Details for d2hg4d3

PDB Entry: 2hg4 (more details), 2.73 Å

PDB Description: Structure of the ketosynthase-acyltransferase didomain of module 5 from DEBS.
PDB Compounds: (D:) 6-Deoxyerythronolide B Synthase

SCOPe Domain Sequences for d2hg4d3:

Sequence, based on SEQRES records: (download)

>d2hg4d3 c.95.1.1 (D:276-457) Ketosynthase domain from 6-deoxyerythronolide B synthase (DEBS), N-terminal domain {Saccharopolyspora erythraea [TaxId: 1836]}
aarregrpvlavlrgsavnqdgasngltapsgpaqqrvirralenagvragdvdyveahg
tgtrlgdpievhallstygaerdpddplwigsvksnightqaaagvagvmkavlalrhge
mprtlhfdepspqiewdlgavsvvsqarswpagerprragvssfgisgtnahviveeape
ad

Sequence, based on observed residues (ATOM records): (download)

>d2hg4d3 c.95.1.1 (D:276-457) Ketosynthase domain from 6-deoxyerythronolide B synthase (DEBS), N-terminal domain {Saccharopolyspora erythraea [TaxId: 1836]}
aarregrpvlavlrgsavnqdgasngltapsgpaqqrvirralenagvragdvdyveahg
tgtrlgdpievhallstygaerdpddplwigsvksnightqaaagvagvmkavlalrhge
mprtlhfdepspqiewdlavsvvsqarswpagerprragvssfgisgtnahviveeapea
d

SCOPe Domain Coordinates for d2hg4d3:

Click to download the PDB-style file with coordinates for d2hg4d3.
(The format of our PDB-style files is described here.)

Timeline for d2hg4d3: