PDB entry 2hg4

View 2hg4 on RCSB PDB site
Description: Structure of the ketosynthase-acyltransferase didomain of module 5 from DEBS.
Class: transferase
Keywords: ketosynthase, acyltransferase, module 5, DEBS, TRANSFERASE
Deposited on 2006-06-26, released 2006-07-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.73 Å
R-factor: 0.218
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 6-Deoxyerythronolide B Synthase
    Species: Saccharopolyspora erythraea [TaxId:1836]
    Gene: eryA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5UNP4
      • modified residue (45)
      • modified residue (90)
      • modified residue (112)
      • modified residue (119)
      • modified residue (192)
      • modified residue (209)
      • modified residue (228)
      • modified residue (384)
      • modified residue (395)
      • modified residue (479)
      • conflict (524)
      • modified residue (554)
      • modified residue (566)
      • modified residue (620)
      • modified residue (679)
      • conflict (731-733)
      • modified residue (785)
    Domains in SCOPe 2.07: d2hg4a1, d2hg4a2, d2hg4a3, d2hg4a4, d2hg4a5, d2hg4a6, d2hg4a7
  • Chain 'B':
    Compound: 6-Deoxyerythronolide B Synthase
    Species: Saccharopolyspora erythraea [TaxId:1836]
    Gene: eryA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5UNP4
      • modified residue (45)
      • modified residue (90)
      • modified residue (112)
      • modified residue (119)
      • modified residue (192)
      • modified residue (209)
      • modified residue (228)
      • modified residue (384)
      • modified residue (395)
      • modified residue (479)
      • conflict (524)
      • modified residue (554)
      • modified residue (566)
      • modified residue (620)
      • modified residue (679)
      • conflict (731-733)
      • modified residue (785)
    Domains in SCOPe 2.07: d2hg4b1, d2hg4b2, d2hg4b3, d2hg4b4, d2hg4b5, d2hg4b6, d2hg4b7
  • Chain 'C':
    Compound: 6-Deoxyerythronolide B Synthase
    Species: Saccharopolyspora erythraea [TaxId:1836]
    Gene: eryA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5UNP4
      • modified residue (45)
      • modified residue (90)
      • modified residue (112)
      • modified residue (119)
      • modified residue (192)
      • modified residue (209)
      • modified residue (228)
      • modified residue (384)
      • modified residue (395)
      • modified residue (479)
      • conflict (524)
      • modified residue (554)
      • modified residue (566)
      • modified residue (620)
      • modified residue (679)
      • conflict (731-733)
      • modified residue (785)
    Domains in SCOPe 2.07: d2hg4c1, d2hg4c2, d2hg4c3, d2hg4c4, d2hg4c5, d2hg4c6, d2hg4c7
  • Chain 'D':
    Compound: 6-Deoxyerythronolide B Synthase
    Species: Saccharopolyspora erythraea [TaxId:1836]
    Gene: eryA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5UNP4
      • modified residue (6)
      • modified residue (45)
      • modified residue (90)
      • modified residue (112)
      • modified residue (119)
      • modified residue (192)
      • modified residue (209)
      • modified residue (228)
      • modified residue (384)
      • modified residue (395)
      • modified residue (479)
      • conflict (524)
      • modified residue (554)
      • modified residue (566)
      • modified residue (620)
      • modified residue (679)
      • conflict (731-733)
      • modified residue (785)
    Domains in SCOPe 2.07: d2hg4d1, d2hg4d2, d2hg4d3, d2hg4d4, d2hg4d5, d2hg4d6, d2hg4d7
  • Chain 'E':
    Compound: 6-Deoxyerythronolide B Synthase
    Species: Saccharopolyspora erythraea [TaxId:1836]
    Gene: eryA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5UNP4
      • modified residue (45)
      • modified residue (90)
      • modified residue (112)
      • modified residue (119)
      • modified residue (192)
      • modified residue (209)
      • modified residue (228)
      • modified residue (384)
      • modified residue (395)
      • modified residue (479)
      • conflict (524)
      • modified residue (554)
      • modified residue (566)
      • modified residue (620)
      • modified residue (679)
      • conflict (731-733)
      • modified residue (785)
    Domains in SCOPe 2.07: d2hg4e1, d2hg4e2, d2hg4e3, d2hg4e4, d2hg4e5, d2hg4e6, d2hg4e7
  • Chain 'F':
    Compound: 6-Deoxyerythronolide B Synthase
    Species: Saccharopolyspora erythraea [TaxId:1836]
    Gene: eryA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5UNP4
      • modified residue (45)
      • modified residue (90)
      • modified residue (112)
      • modified residue (119)
      • modified residue (192)
      • modified residue (209)
      • modified residue (228)
      • modified residue (384)
      • modified residue (395)
      • modified residue (479)
      • conflict (524)
      • modified residue (554)
      • modified residue (566)
      • modified residue (620)
      • modified residue (679)
      • conflict (731-733)
      • modified residue (785)
    Domains in SCOPe 2.07: d2hg4f1, d2hg4f2, d2hg4f3, d2hg4f4, d2hg4f5, d2hg4f6, d2hg4f7
  • Heterogens: ACT, SO4, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hg4A (A:)
    msgdngmteeklrrylkrtvteldsvtarlrevehragepiaivgmacrfpgdvdspesf
    wefvsgggdaiaeapadrgwepdpdarlggmlaaagdfdagffgisprealamdpqqrim
    leiswealeraghdpvslrgsatgvftgvgtvdygprpdeapdevlgyvgtgtassvasg
    rvayclglegpamtvdtacssgltalhlameslrrdecglalaggvtvmsspgaftefrs
    qgglaadgrckpfskaadgfglaegagvlvlqrlsaarregrpvlavlrgsavnqdgasn
    gltapsgpaqqrvirralenagvragdvdyveahgtgtrlgdpievhallstygaerdpd
    dplwigsvksnightqaaagvagvmkavlalrhgemprtlhfdepspqiewdlgavsvvs
    qarswpagerprragvssfgisgtnahviveeapeadepepapdsgpvplvlsgrdeqam
    raqagrladhlareprnslrdtgftlatrrsawehravvvgdrdealaglravadgriad
    rtatgqartrrgvamvfpgqgaqwqgmardllresqvfadsirdceralaphvdwsltdl
    lsgarpldrvdvvqpalfavmvslaalwrshgvepaavvghsqgeiaaahvagaltleda
    aklvavrsrvlrrlggqggmasfglgteqaaerigrfagalsiasvngprsvvvagesgp
    ldeliaeceaeahkarripvdyashspqveslreelltelagispvsadvalystttgqp
    idtatmdtaywyanlreqvrfqdatrqlaeagfdafvevsphpvltvgieatldsalpad
    agacvvgtlrrdrggladfhtalgeayaqgvevdwspafadarpvelpvypfqrqrywlp
    iptggrardedddwryq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hg4A (A:)
    eeklrrylkrtvteldsvtarlrevehragepiaivgmacrfpgdvdspesfwefvsggg
    daiaeapadrgwepdpdarlggmlaaagdfdagffgisprealamdpqqrimleisweal
    eraghdpvslrgsatgvftgvgtvdygprpdeapdevlgyvgtgtassvasgrvayclgl
    egpamtvdtacssgltalhlameslrrdecglalaggvtvmsspgaftefrsqgglaadg
    rckpfskaadgfglaegagvlvlqrlsaarregrpvlavlrgsavnqdgasngltapsgp
    aqqrvirralenagvragdvdyveahgtgtrlgdpievhallstygaerdpddplwigsv
    ksnightqaaagvagvmkavlalrhgemprtlhfdepspqiewavsvvsqarswpagerp
    rragvssfgisgtnahviveeapeadgpvplvlsgrdeqamraqagrladhlareprnsl
    rdtgftlatrrsawehravvvgdrdealaglravadgriadrtatgqartrrgvamvfpg
    qgaqwqgmardllresqvfadsirdceralaphvdwsltdllsgarpldrvdvvqpalfa
    vmvslaalwrshgvepaavvghsqgeiaaahvagaltledaaklvavrsrvlrrlggqgg
    masfglgteqaaerigrfagalsiasvngprsvvvagesgpldeliaeceaeahkarrip
    vdyashspqveslreelltelagispvsadvalystttgqpidtatmdtaywyanlreqv
    rfqdatrqlaeagfdafvevsphpvltvgieatldsalpadagacvvgtlrrdrggladf
    htalgeayaqgvevdwspafadarpvelpvypfqrqrywlpi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2hg4B (B:)
    msgdngmteeklrrylkrtvteldsvtarlrevehragepiaivgmacrfpgdvdspesf
    wefvsgggdaiaeapadrgwepdpdarlggmlaaagdfdagffgisprealamdpqqrim
    leiswealeraghdpvslrgsatgvftgvgtvdygprpdeapdevlgyvgtgtassvasg
    rvayclglegpamtvdtacssgltalhlameslrrdecglalaggvtvmsspgaftefrs
    qgglaadgrckpfskaadgfglaegagvlvlqrlsaarregrpvlavlrgsavnqdgasn
    gltapsgpaqqrvirralenagvragdvdyveahgtgtrlgdpievhallstygaerdpd
    dplwigsvksnightqaaagvagvmkavlalrhgemprtlhfdepspqiewdlgavsvvs
    qarswpagerprragvssfgisgtnahviveeapeadepepapdsgpvplvlsgrdeqam
    raqagrladhlareprnslrdtgftlatrrsawehravvvgdrdealaglravadgriad
    rtatgqartrrgvamvfpgqgaqwqgmardllresqvfadsirdceralaphvdwsltdl
    lsgarpldrvdvvqpalfavmvslaalwrshgvepaavvghsqgeiaaahvagaltleda
    aklvavrsrvlrrlggqggmasfglgteqaaerigrfagalsiasvngprsvvvagesgp
    ldeliaeceaeahkarripvdyashspqveslreelltelagispvsadvalystttgqp
    idtatmdtaywyanlreqvrfqdatrqlaeagfdafvevsphpvltvgieatldsalpad
    agacvvgtlrrdrggladfhtalgeayaqgvevdwspafadarpvelpvypfqrqrywlp
    iptggrardedddwryq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hg4B (B:)
    eeklrrylkrtvteldsvtarlrevehragepiaivgmacrfpgdvdspesfwefvsggg
    daiaeapadrgwepdpdarlggmlaaagdfdagffgisprealamdpqqrimleisweal
    eraghdpvslrgsatgvftgvgtvdygprpdeapdevlgyvgtgtassvasgrvayclgl
    egpamtvdtacssgltalhlameslrrdecglalaggvtvmsspgaftefrsqgglaadg
    rckpfskaadgfglaegagvlvlqrlsaarregrpvlavlrgsavnqdgasngltapsgp
    aqqrvirralenagvragdvdyveahgtgtrlgdpievhallstygaerdpddplwigsv
    ksnightqaaagvagvmkavlalrhgemprtlhfdepspqiewavsvvsqarswpagerp
    rragvssfgisgtnahviveeapeadgpvplvlsgrdeqamraqagrladhlareprnsl
    rdtgftlatrrsawehravvvgdrdealaglravadgriadrtatgqartrrgvamvfpg
    qgaqwqgmardllresqvfadsirdceralaphvdwsltdllsgarpldrvdvvqpalfa
    vmvslaalwrshgvepaavvghsqgeiaaahvagaltledaaklvavrsrvlrrlggqgg
    masfglgteqaaerigrfagalsiasvngprsvvvagesgpldeliaeceaeahkarrip
    vdyashspqveslreelltelagispvsadvalystttgqpidtatmdtaywyanlreqv
    rfqdatrqlaeagfdafvevsphpvltvgieatldsalpadagacvvgtlrrdrggladf
    htalgeayaqgvevdwspafadarpvelpvypfqrqrywlpi
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2hg4C (C:)
    msgdngmteeklrrylkrtvteldsvtarlrevehragepiaivgmacrfpgdvdspesf
    wefvsgggdaiaeapadrgwepdpdarlggmlaaagdfdagffgisprealamdpqqrim
    leiswealeraghdpvslrgsatgvftgvgtvdygprpdeapdevlgyvgtgtassvasg
    rvayclglegpamtvdtacssgltalhlameslrrdecglalaggvtvmsspgaftefrs
    qgglaadgrckpfskaadgfglaegagvlvlqrlsaarregrpvlavlrgsavnqdgasn
    gltapsgpaqqrvirralenagvragdvdyveahgtgtrlgdpievhallstygaerdpd
    dplwigsvksnightqaaagvagvmkavlalrhgemprtlhfdepspqiewdlgavsvvs
    qarswpagerprragvssfgisgtnahviveeapeadepepapdsgpvplvlsgrdeqam
    raqagrladhlareprnslrdtgftlatrrsawehravvvgdrdealaglravadgriad
    rtatgqartrrgvamvfpgqgaqwqgmardllresqvfadsirdceralaphvdwsltdl
    lsgarpldrvdvvqpalfavmvslaalwrshgvepaavvghsqgeiaaahvagaltleda
    aklvavrsrvlrrlggqggmasfglgteqaaerigrfagalsiasvngprsvvvagesgp
    ldeliaeceaeahkarripvdyashspqveslreelltelagispvsadvalystttgqp
    idtatmdtaywyanlreqvrfqdatrqlaeagfdafvevsphpvltvgieatldsalpad
    agacvvgtlrrdrggladfhtalgeayaqgvevdwspafadarpvelpvypfqrqrywlp
    iptggrardedddwryq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hg4C (C:)
    eeklrrylkrtvteldsvtarlrevehragepiaivgmacrfpgdvdspesfwefvsggg
    daiaeapadrgwepdpdarlggmlaaagdfdagffgisprealamdpqqrimleisweal
    eraghdpvslrgsatgvftgvgtvdygprpdeapdevlgyvgtgtassvasgrvayclgl
    egpamtvdtacssgltalhlameslrrdecglalaggvtvmsspgaftefrsqgglaadg
    rckpfskaadgfglaegagvlvlqrlsaarregrpvlavlrgsavnqdgasngltapsgp
    aqqrvirralenagvragdvdyveahgtgtrlgdpievhallstygaerdpddplwigsv
    ksnightqaaagvagvmkavlalrhgemprtlhfdepspqiewavsvvsqarswpagerp
    rragvssfgisgtnahviveeapeadgpvplvlsgrdeqamraqagrladhlareprnsl
    rdtgftlatrrsawehravvvgdrdealaglravadgriadrtatgqartrrgvamvfpg
    qgaqwqgmardllresqvfadsirdceralaphvdwsltdllsgarpldrvdvvqpalfa
    vmvslaalwrshgvepaavvghsqgeiaaahvagaltledaaklvavrsrvlrrlggqgg
    masfglgteqaaerigrfagalsiasvngprsvvvagesgpldeliaeceaeahkarrip
    vdyashspqveslreelltelagispvsadvalystttgqpidtatmdtaywyanlreqv
    rfqdatrqlaeagfdafvevsphpvltvgieatldsalpadagacvvgtlrrdrggladf
    htalgeayaqgvevdwspafadarpvelpvypfqrqrywlpi
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2hg4D (D:)
    msgdngmteeklrrylkrtvteldsvtarlrevehragepiaivgmacrfpgdvdspesf
    wefvsgggdaiaeapadrgwepdpdarlggmlaaagdfdagffgisprealamdpqqrim
    leiswealeraghdpvslrgsatgvftgvgtvdygprpdeapdevlgyvgtgtassvasg
    rvayclglegpamtvdtacssgltalhlameslrrdecglalaggvtvmsspgaftefrs
    qgglaadgrckpfskaadgfglaegagvlvlqrlsaarregrpvlavlrgsavnqdgasn
    gltapsgpaqqrvirralenagvragdvdyveahgtgtrlgdpievhallstygaerdpd
    dplwigsvksnightqaaagvagvmkavlalrhgemprtlhfdepspqiewdlgavsvvs
    qarswpagerprragvssfgisgtnahviveeapeadepepapdsgpvplvlsgrdeqam
    raqagrladhlareprnslrdtgftlatrrsawehravvvgdrdealaglravadgriad
    rtatgqartrrgvamvfpgqgaqwqgmardllresqvfadsirdceralaphvdwsltdl
    lsgarpldrvdvvqpalfavmvslaalwrshgvepaavvghsqgeiaaahvagaltleda
    aklvavrsrvlrrlggqggmasfglgteqaaerigrfagalsiasvngprsvvvagesgp
    ldeliaeceaeahkarripvdyashspqveslreelltelagispvsadvalystttgqp
    idtatmdtaywyanlreqvrfqdatrqlaeagfdafvevsphpvltvgieatldsalpad
    agacvvgtlrrdrggladfhtalgeayaqgvevdwspafadarpvelpvypfqrqrywlp
    iptggrardedddwryq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hg4D (D:)
    mteeklrrylkrtvteldsvtarlrevehragepiaivgmacrfpgdvdspesfwefvsg
    ggdaiaeapadrgwepdpdarlggmlaaagdfdagffgisprealamdpqqrimleiswe
    aleraghdpvslrgsatgvftgvgtvdygprpdeapdevlgyvgtgtassvasgrvaycl
    glegpamtvdtacssgltalhlameslrrdecglalaggvtvmsspgaftefrsqgglaa
    dgrckpfskaadgfglaegagvlvlqrlsaarregrpvlavlrgsavnqdgasngltaps
    gpaqqrvirralenagvragdvdyveahgtgtrlgdpievhallstygaerdpddplwig
    svksnightqaaagvagvmkavlalrhgemprtlhfdepspqiewdlavsvvsqarswpa
    gerprragvssfgisgtnahviveeapeadgpvplvlsgrdeqamraqagrladhlarep
    rnslrdtgftlatrrsawehravvvgdrdealaglravadgriadrtatgqartrrgvam
    vfpgqqwqgmardllresqvfadsirdceralaphvdwsltdllsgarpldrvdvvqpal
    favmvslaalwrshgvepaavvghsqgeiaaahvagaltledaaklvavrsrvlrrlggq
    ggmasfglgteqaaerigrfagalsiasvngprsvvvagesgpldeliaeceaeahkarr
    ipvdyashspqveslreelltelagispvsadvalystttgqpidtatmdtaywyanlre
    qvrfqdatrqlaeagfdafvevsphpvltvgieatldsalpadagacvvgtlrrdrggla
    dfhtalgeayaqgvevdwspafadarpvelpvypfqrqrywlpi
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2hg4E (E:)
    msgdngmteeklrrylkrtvteldsvtarlrevehragepiaivgmacrfpgdvdspesf
    wefvsgggdaiaeapadrgwepdpdarlggmlaaagdfdagffgisprealamdpqqrim
    leiswealeraghdpvslrgsatgvftgvgtvdygprpdeapdevlgyvgtgtassvasg
    rvayclglegpamtvdtacssgltalhlameslrrdecglalaggvtvmsspgaftefrs
    qgglaadgrckpfskaadgfglaegagvlvlqrlsaarregrpvlavlrgsavnqdgasn
    gltapsgpaqqrvirralenagvragdvdyveahgtgtrlgdpievhallstygaerdpd
    dplwigsvksnightqaaagvagvmkavlalrhgemprtlhfdepspqiewdlgavsvvs
    qarswpagerprragvssfgisgtnahviveeapeadepepapdsgpvplvlsgrdeqam
    raqagrladhlareprnslrdtgftlatrrsawehravvvgdrdealaglravadgriad
    rtatgqartrrgvamvfpgqgaqwqgmardllresqvfadsirdceralaphvdwsltdl
    lsgarpldrvdvvqpalfavmvslaalwrshgvepaavvghsqgeiaaahvagaltleda
    aklvavrsrvlrrlggqggmasfglgteqaaerigrfagalsiasvngprsvvvagesgp
    ldeliaeceaeahkarripvdyashspqveslreelltelagispvsadvalystttgqp
    idtatmdtaywyanlreqvrfqdatrqlaeagfdafvevsphpvltvgieatldsalpad
    agacvvgtlrrdrggladfhtalgeayaqgvevdwspafadarpvelpvypfqrqrywlp
    iptggrardedddwryq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hg4E (E:)
    lkrtvteldsvtarlrevehragepiaivgmacrfpgdvdspesfwefvsgggdaiaeap
    adrgwepdpdarlggmlaaagdfdagffgisprealamdpqqrimleiswealeraghdp
    vslrgsatgvftgvgtvdygprpdeapdevlgyvgtgtassvasgrvayclglegpamtv
    dtacssgltalhlameslrrdecglalaggvtvmsspgaftefrsqgglaadgrckpfsk
    aadgfglaegagvlvlqrlsaarregrpvlavlrgsavnqdgasngltapsgpaqqrvir
    ralenagvragdvdyveahgtgtrlgdpievhallstygaerdpddplwigsvksnight
    qaaagvagvmkavlalrhgemprtlhfdepspqiewdlavsvvsqarswpagerprragv
    ssfgisgtnahviveeapeadgpvplvlsgrdeqamraqagrladhlareprnslrdtgf
    tlatrrsawehravvvgdrdealaglravadgriadrtatgqartrrgvamvfpgqgaqw
    qgmardllresqvfadsirdceralaphvdwsltdllsgarpldrvdvvqpalfavmvsl
    aalwrshgvepaavvghsqgeiaaahvagaltledaaklvavrsrvlrrlggqggmasfg
    lgteqaaerigrfagalsiasvngprsvvvagesgpldeliaeceaeahkarripvdyas
    hspqveslreelltelagispvsadvalystttgqpidtatmdtaywyanlreqvrfqda
    trqlaeagfdafvevsphpvltvgieatldsalpadagacvvgtlrrdrggladfhtalg
    eayaqgvevdwspafadarpvelpvypfqrqrywlpi
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2hg4F (F:)
    msgdngmteeklrrylkrtvteldsvtarlrevehragepiaivgmacrfpgdvdspesf
    wefvsgggdaiaeapadrgwepdpdarlggmlaaagdfdagffgisprealamdpqqrim
    leiswealeraghdpvslrgsatgvftgvgtvdygprpdeapdevlgyvgtgtassvasg
    rvayclglegpamtvdtacssgltalhlameslrrdecglalaggvtvmsspgaftefrs
    qgglaadgrckpfskaadgfglaegagvlvlqrlsaarregrpvlavlrgsavnqdgasn
    gltapsgpaqqrvirralenagvragdvdyveahgtgtrlgdpievhallstygaerdpd
    dplwigsvksnightqaaagvagvmkavlalrhgemprtlhfdepspqiewdlgavsvvs
    qarswpagerprragvssfgisgtnahviveeapeadepepapdsgpvplvlsgrdeqam
    raqagrladhlareprnslrdtgftlatrrsawehravvvgdrdealaglravadgriad
    rtatgqartrrgvamvfpgqgaqwqgmardllresqvfadsirdceralaphvdwsltdl
    lsgarpldrvdvvqpalfavmvslaalwrshgvepaavvghsqgeiaaahvagaltleda
    aklvavrsrvlrrlggqggmasfglgteqaaerigrfagalsiasvngprsvvvagesgp
    ldeliaeceaeahkarripvdyashspqveslreelltelagispvsadvalystttgqp
    idtatmdtaywyanlreqvrfqdatrqlaeagfdafvevsphpvltvgieatldsalpad
    agacvvgtlrrdrggladfhtalgeayaqgvevdwspafadarpvelpvypfqrqrywlp
    iptggrardedddwryq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hg4F (F:)
    vteldsvtarlrevehragepiaivgmacrfpgdvdspesfwefvsgggdaiaeapadrg
    wepdpdarlggmlaaagdfdagffgisprealamdpqqrimleiswealeraghdpvslr
    gsatgvftgvgtvdygprpdeapdevlgyvgtgtassvasgrvayclglegpamtvdtac
    ssgltalhlameslrrdecglalaggvtvmsspgaftefrsqgglaadgrckpfskaadg
    fglaegagvlvlqrlsaarregrpvlavlrgsavnqdgasngltapsgpaqqrvirrale
    nagvragdvdyveahgtgtrlgdpievhallstygaerdpddplwigsvksnightqaaa
    gvagvmkavlalrhgemprtlhfdepspqiewdlgavsvvsqarswpagerprragvssf
    gisgtnahviveeapeadgpvplvlsgrdeqamraqagrladhlareprnslrdtgftla
    trrsawehravvvgdrdealaglravadgriadrtatgqartrrgvamvfpgqgaqwqgm
    ardllresqvfadsirdceralaphvdwsltdllsgarpldrvdvvqpalfavmvslaal
    wrshgvepaavvghsqgeiaaahvagaltledaaklvavrsrvlrrlggqggmasfglgt
    eqaaerigrfagalsiasvngprsvvvagesgpldeliaeceaeahkarripvdyashsp
    qveslreelltelagispvsadvalystttgqpidtatmdtaywyanlreqvrfqdatrq
    laeagfdafvevsphpvltvgieatldsalpadagacvvgtlrrdrggladfhtalgeay
    aqgvevdwspafadarpvelpvypfqrqrywlpi