SCOPe 2.08: Domain d2hg4a5: 2hg4 A:678-741

Lineage for d2hg4a5 (2hg4 A:678-741)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.23: Probable ACP-binding domain of malonyl-CoA ACP transacylase [55048] (1 family)

5. Family d.58.23.1: Probable ACP-binding domain of malonyl-CoA ACP transacylase [55049] (2 proteins)

6. Protein Ferredoxin-like domain from acyl transferase (AT) domain of 6-deoxyerythronolide B synthase (DEBS) [310771] (1 species)

7. Species Saccharopolyspora erythraea [TaxId:1836] [311027] (1 PDB entry)

8. Domain d2hg4a5: 2hg4 A:678-741 [303973]
   Other proteins in same PDB: d2hg4a1, d2hg4a2, d2hg4a3, d2hg4a4, d2hg4a6, d2hg4a7, d2hg4b1, d2hg4b2, d2hg4b3, d2hg4b4, d2hg4b6, d2hg4b7, d2hg4c1, d2hg4c2, d2hg4c3, d2hg4c4, d2hg4c6, d2hg4c7, d2hg4d1, d2hg4d2, d2hg4d3, d2hg4d4, d2hg4d6, d2hg4d7, d2hg4e1, d2hg4e2, d2hg4e3, d2hg4e4, d2hg4e6, d2hg4e7, d2hg4f1, d2hg4f2, d2hg4f3, d2hg4f4, d2hg4f6, d2hg4f7
   complexed with act, cl, so4

Details for d2hg4a5

PDB Entry: 2hg4, 2.73 Å

PDB Description: Structure of the ketosynthase-acyltransferase didomain of module 5 from DEBS.

PDB Compounds: (A:) 6-Deoxyerythronolide B Synthase

SCOPe Domain Sequences for d2hg4a5:

Sequence; same for both SEQRES and ATOM records:

>d2hg4a5 d.58.23.1 (A:678-741) Ferredoxin-like domain from acyl transferase (AT) domain of 6-deoxyerythronolide B synthase (DEBS) {Saccharopolyspora erythraea [TaxId: 1836]}
ggmasfglgteqaaerigrfagalsiasvngprsvvvagesgpldeliaeceaeahkarr
ipvd

Timeline for d2hg4a5:

• d2hg4a5 first appeared in SCOPe 2.06
  
• d2hg4a5 appears in SCOPe 2.07