SCOPe 2.08: Domain d2hg4f3: 2hg4 F:276-457

Lineage for d2hg4f3 (2hg4 F:276-457)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.1: Thiolase-related [53902] (20 proteins)

6. Protein Ketosynthase domain from 6-deoxyerythronolide B synthase (DEBS), N-terminal domain [419024] (1 species)

7. Species Saccharopolyspora erythraea [TaxId:1836] [419506] (1 PDB entry)

8. Domain d2hg4f3: 2hg4 F:276-457 [304006]
   Other proteins in same PDB: d2hg4a1, d2hg4a2, d2hg4a4, d2hg4a5, d2hg4a6, d2hg4a7, d2hg4b1, d2hg4b2, d2hg4b4, d2hg4b5, d2hg4b6, d2hg4b7, d2hg4c1, d2hg4c2, d2hg4c4, d2hg4c5, d2hg4c6, d2hg4c7, d2hg4d1, d2hg4d2, d2hg4d4, d2hg4d5, d2hg4d6, d2hg4d7, d2hg4e1, d2hg4e2, d2hg4e4, d2hg4e5, d2hg4e6, d2hg4e7, d2hg4f1, d2hg4f2, d2hg4f4, d2hg4f5, d2hg4f6, d2hg4f7
   complexed with act, cl, so4
   has additional insertions and/or extensions that are not grouped together

Details for d2hg4f3

PDB Entry: 2hg4, 2.73 Å

PDB Description: Structure of the ketosynthase-acyltransferase didomain of module 5 from DEBS.

PDB Compounds: (F:) 6-Deoxyerythronolide B Synthase

SCOPe Domain Sequences for d2hg4f3:

Sequence; same for both SEQRES and ATOM records:

>d2hg4f3 c.95.1.1 (F:276-457) Ketosynthase domain from 6-deoxyerythronolide B synthase (DEBS), N-terminal domain {Saccharopolyspora erythraea [TaxId: 1836]}
aarregrpvlavlrgsavnqdgasngltapsgpaqqrvirralenagvragdvdyveahg
tgtrlgdpievhallstygaerdpddplwigsvksnightqaaagvagvmkavlalrhge
mprtlhfdepspqiewdlgavsvvsqarswpagerprragvssfgisgtnahviveeape
ad

Timeline for d2hg4f3:

• d2hg4f3 first appeared in SCOPe 2.06
  
• d2hg4f3 appears in SCOPe 2.07