SCOPe 2.08: Domain d2ehog2: 2eho G:1-61

Lineage for d2ehog2 (2eho G:1-61)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.344: GINS/PriA/YqbF domain [160058] (1 superfamily)
   beta(4)-alpha-beta; 3-stranded antiparallel beta-sheet (strands 4,1 and 5) are covered on the same side by the helix and beta hairpin of strands 2 and 3; similarity to the L9 N-domain-like fold (55657) and the PsaD fold (64243)

4. Superfamily d.344.1: PriA/YqbF domain [160059] (5 families)
   associated with known or presumed DNA-binding domains; this superfamily also includes the C-terminal domain of PriA (PDB entry 1zt2)

5. Family d.344.1.0: automated matches [254227] (1 protein)
   not a true family

6. Protein automated matches [254515] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255135] (3 PDB entries)

8. Domain d2ehog2: 2eho G:1-61 [146853]
   Other proteins in same PDB: d2ehoa1, d2ehob1, d2ehoc1, d2ehoc2, d2ehoc3, d2ehod1, d2ehod2, d2ehoe1, d2ehof2, d2ehof3, d2ehog1, d2ehog3, d2ehoh1, d2ehoh2, d2ehoi1, d2ehoj_, d2ehok1, d2ehok3, d2ehol1, d2ehol2
   automated match to d2q9qa2
   complexed with so4

Details for d2ehog2

PDB Entry: 2eho, 3 Å

PDB Description: Crystal structure of human GINS complex

PDB Compounds: (G:) DNA replication complex GINS protein PSF2

SCOPe Domain Sequences for d2ehog2:

Sequence; same for both SEQRES and ATOM records:

>d2ehog2 d.344.1.0 (G:1-61) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mdaaeveflaekelvtiipnfsldkiyliggdlgpfnpglpvevplwlainlkqrqkcrl
l

Timeline for d2ehog2:

• d2ehog2 first appeared in SCOP 1.75
  
• d2ehog2 appears in SCOPe 2.07