SCOPe 2.08: Domain d2ehod2: 2eho D:3-87

Lineage for d2ehod2 (2eho D:3-87)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.344: GINS/PriA/YqbF domain [160058] (1 superfamily)
   beta(4)-alpha-beta; 3-stranded antiparallel beta-sheet (strands 4,1 and 5) are covered on the same side by the helix and beta hairpin of strands 2 and 3; similarity to the L9 N-domain-like fold (55657) and the PsaD fold (64243)

4. Superfamily d.344.1: PriA/YqbF domain [160059] (5 families)
   associated with known or presumed DNA-binding domains; this superfamily also includes the C-terminal domain of PriA (PDB entry 1zt2)

5. Family d.344.1.4: PSF3 N-terminal domain-like [160071] (1 protein)
   N-terminal part of Pfam PF06425

6. Protein GINS complex subunit 3, PSF3 [160072] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [160073] (3 PDB entries)
   Uniprot Q9BRX5 1-87

8. Domain d2ehod2: 2eho D:3-87 [146849]
   Other proteins in same PDB: d2ehoa1, d2ehob1, d2ehoc1, d2ehoc2, d2ehoc3, d2ehod1, d2ehoe1, d2ehoe2, d2ehof2, d2ehof3, d2ehog1, d2ehog2, d2ehog3, d2ehoh1, d2ehoi1, d2ehoi2, d2ehoj_, d2ehok1, d2ehok2, d2ehok3, d2ehol1
   automated match to d2e9xc2
   complexed with so4

Details for d2ehod2

PDB Entry: 2eho, 3 Å

PDB Description: Crystal structure of human GINS complex

PDB Compounds: (D:) GINS complex subunit 3

SCOPe Domain Sequences for d2ehod2:

Sequence, based on SEQRES records:

>d2ehod2 d.344.1.4 (D:3-87) GINS complex subunit 3, PSF3 {Human (Homo sapiens) [TaxId: 9606]}
eayfrvesgalgpeenflslddilmsheklpvrtetamprlgafflersagaetdnavpq
gsklelplwlakglfdnkrrilsve

Sequence, based on observed residues (ATOM records):

>d2ehod2 d.344.1.4 (D:3-87) GINS complex subunit 3, PSF3 {Human (Homo sapiens) [TaxId: 9606]}
eayfrvesgalgpeenflslddilmsheklpvrtetamprlgafflenavpqgsklelpl
wlakglfdnkrrilsve

Timeline for d2ehod2:

• d2ehod2 first appeared in SCOP 1.75
  
• d2ehod2 appears in SCOPe 2.07