SCOPe 2.08: Domain d2ehog1: 2eho G:62-175

Lineage for d2ehog1 (2eho G:62-175)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.278: GINS helical bundle-like [158572] (1 superfamily)
   5 helices, staggered bundle;

4. Superfamily a.278.1: GINS helical bundle-like [158573] (4 families)
   common to all subunits of the GINS complex

5. Family a.278.1.2: PSF2 C-terminal domain-like [158577] (1 protein)
   C-terminal part of Pfam PF05916

6. Protein DNA replication complex GINS protein PSF2 [158578] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [158579] (3 PDB entries)
   Uniprot Q9Y248 62-173

8. Domain d2ehog1: 2eho G:62-175 [146852]
   Other proteins in same PDB: d2ehoa1, d2ehob1, d2ehoc2, d2ehoc3, d2ehod1, d2ehod2, d2ehoe1, d2ehoe2, d2ehof2, d2ehof3, d2ehog2, d2ehog3, d2ehoh1, d2ehoh2, d2ehoi1, d2ehoi2, d2ehoj_, d2ehok2, d2ehok3, d2ehol1, d2ehol2
   automated match to d2q9qa1
   complexed with so4

Details for d2ehog1

PDB Entry: 2eho, 3 Å

PDB Description: Crystal structure of human GINS complex

PDB Compounds: (G:) DNA replication complex GINS protein PSF2

SCOPe Domain Sequences for d2ehog1:

Sequence; same for both SEQRES and ATOM records:

>d2ehog1 a.278.1.2 (G:62-175) DNA replication complex GINS protein PSF2 {Human (Homo sapiens) [TaxId: 9606]}
ppewmdveklekmrdherkeetftpmpspyymeltklllnhasdnipkadeirtlvkdmw
dtriaklrvsadsfvrqqeahakldnltlmeintsgtfltqalnhmyklrtnlq

Timeline for d2ehog1:

• d2ehog1 first appeared in SCOP 1.75
  
• d2ehog1 appears in SCOPe 2.07