SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2ehoc1 (2eho C:62-173)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2016588Fold a.278: GINS helical bundle-like [158572] (1 superfamily)
    5 helices, staggered bundle;
  4. 2016589Superfamily a.278.1: GINS helical bundle-like [158573] (4 families) (S)
    common to all subunits of the GINS complex
  5. 2016602Family a.278.1.2: PSF2 C-terminal domain-like [158577] (1 protein)
    C-terminal part of Pfam PF05916
  6. 2016603Protein DNA replication complex GINS protein PSF2 [158578] (1 species)
  7. 2016604Species Human (Homo sapiens) [TaxId:9606] [158579] (3 PDB entries)
    Uniprot Q9Y248 62-173
  8. 2016609Domain d2ehoc1: 2eho C:62-173 [146846]
    Other proteins in same PDB: d2ehoa1, d2ehob1, d2ehoc2, d2ehoc3, d2ehod1, d2ehod2, d2ehoe1, d2ehoe2, d2ehof2, d2ehof3, d2ehog2, d2ehog3, d2ehoh1, d2ehoh2, d2ehoi1, d2ehoi2, d2ehoj_, d2ehok2, d2ehok3, d2ehol1, d2ehol2
    complexed with so4

Details for d2ehoc1

PDB Entry: 2eho (more details), 3 Å

PDB Description: Crystal structure of human GINS complex
PDB Compounds: (C:) DNA replication complex GINS protein PSF2

SCOPe Domain Sequences for d2ehoc1:

Sequence, based on SEQRES records: (download)

>d2ehoc1 a.278.1.2 (C:62-173) DNA replication complex GINS protein PSF2 {Human (Homo sapiens) [TaxId: 9606]}
ppewmdveklekmrdherkeetftpmpspyymeltklllnhasdnipkadeirtlvkdmw
dtriaklrvsadsfvrqqeahakldnltlmeintsgtfltqalnhmyklrtn

Sequence, based on observed residues (ATOM records): (download)

>d2ehoc1 a.278.1.2 (C:62-173) DNA replication complex GINS protein PSF2 {Human (Homo sapiens) [TaxId: 9606]}
ppewmdveklekmrdherkeetftpmpspyymeltklllnhasdnipkadeirtlvkdmw
dtriaklrvsadsfvrqqdnltlmeintsgtfltqalnhmyklrtn

SCOPe Domain Coordinates for d2ehoc1:

Click to download the PDB-style file with coordinates for d2ehoc1.
(The format of our PDB-style files is described here.)

Timeline for d2ehoc1: